PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g018780m
Common NameCISIN_1g018825mg, LOC102611222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 351aa    MW: 39503.7 Da    PI: 7.2367
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g018780mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF657.9e-211154245
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       + en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  orange1.1g018780m 11 KLENTNGRQATYAKRKHGIMKKANELSILCDIDIILLMFSPTGK 54
                       6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-28261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.563254IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-25395IPR002100Transcription factor, MADS-box
CDDcd002661.95E-25382No hitNo description
PRINTSPR004042.9E-16424IPR002100Transcription factor, MADS-box
PfamPF003193.1E-181255IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-162439IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-163960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MMGRVKLKIK KLENTNGRQA TYAKRKHGIM KKANELSILC DIDIILLMFS PTGKPSLCNG  60
KRSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFLGTS SQTIEDLTNQ  120
ARLLQSQLSE MHRRLRYWTN PDKINSVEHL GQMENSLRDS LNHLRMHKEN LGKQELMSLE  180
CTTQFQNGIC IPFRMGSEEQ LQTLSWIPNN DNRHMVLPED PNLLSHRDVE CSGSSSFGSY  240
SGYFGPGKSS EISNSGQDSS LLSELSGTQS LRLQLGGQCS YIPYNVSLLN DKFQPVSEMN  300
IQENPVDYHV SGSLEVPRPG FDTTPGSWAS TSGPCEVTLF DERLYSQQLN *
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024041455.10.0agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-119AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A067H5G90.0A0A067H5G9_CITSI; Uncharacterized protein
STRINGXP_006483134.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-94AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]