PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g018343m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 358aa    MW: 38975.6 Da    PI: 7.3589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g018343mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-12112156347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  orange1.1g018343m 112 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKY 156
                        8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.65105161IPR017930Myb domain
SuperFamilySSF466894.64E-17105162IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-18108160IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.5E-11109155IPR009057Homeodomain-like
SMARTSM007177.0E-10109159IPR001005SANT/Myb domain
CDDcd001671.09E-8112157No hitNo description
PfamPF002499.0E-11112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGSSPGVG GLKLFGVRLT DGSIIKKSAS MGNLSALHYH  60
SSSSAAASPN PDSPLSDHVR DPNHLTDGYL SDDPAHGSGS SNRRCERKKG VPWTEEEHRL  120
FLIGLQKLGK GDWRGIARNY VMSRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMVADDM  180
ATDTPPVPEE QVMLPSPLAR ESDNTSSQPS LNLSLSTEFE PMEAVCKETE KDSEEPVIDL  240
NEFTPMVSSF FPAYMPVPYT YWPHNAATGE EDKDAGTSGN HPILKPIPIL PKEPVNVDQL  300
VCMSQLSIGE TERGLREPSP LSLKLLGEPS RQSAFHANAP VSRSDLSKGK TTPIQAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.18650.0flower| fruit| leaf| vegetative meristem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006465688.10.0transcription factor MYBS3
SwissprotQ7XC571e-96MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLV4SSM00.0V4SSM0_9ROSI; Uncharacterized protein
STRINGXP_006465688.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-107MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]