PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g017956m
Common NameCISIN_1g017956mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 364aa    MW: 42164.4 Da    PI: 6.5327
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g017956mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.95e-27239323186
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        rW++ e++aLi +r+ +e+++    +k  lWe++s+ mr+ g++rs+k+Ckekwen+nk+++k  e+ kk+  e+s+tc+yf++le
  orange1.1g017956m 239 RWPEAEIQALIMLRTTLEHQFHGVGSKFSLWERISDGMRKMGYHRSAKKCKEKWENMNKYFRKSMENGKKH-LERSKTCQYFHDLE 323
                        8********************************************************************99.57778*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.64E-5237303IPR009057Homeodomain-like
CDDcd122032.23E-24238302No hitNo description
PfamPF138376.7E-19238324No hitNo description
PROSITE profilePS500906.876239296IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MEIRTGDRES EFPQQITPFP ESINQPPVTE SVNAPLQKLR PIRRSPADDP PSFEAAADKS  60
LKFGSGSVAE SLGPMSMWFD TEDESSSSSD SDIHVDLFTE IKEPGSQKRK RKTRVKIETF  120
LESLVMKIMD KQEQMNKQLI DMIAKRERER VIREEAWKQQ EMERMKRDEE IRAQETARSI  180
ALISFIQNFL GHEIQLPQPA MVSNVEENGS KDGRNHAENN ITQNANNRKW PEACDPNRRW  240
PEAEIQALIM LRTTLEHQFH GVGSKFSLWE RISDGMRKMG YHRSAKKCKE KWENMNKYFR  300
KSMENGKKHL ERSKTCQYFH DLEMYRNGLV NPGNVTNFPN FENFSESDAS NFTNQEIAAK  360
IED*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467269.10.0trihelix transcription factor GTL1
RefseqXP_006467270.10.0trihelix transcription factor GTL1
TrEMBLA0A067GG050.0A0A067GG05_CITSI; Uncharacterized protein
STRINGXP_006467269.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94112736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.12e-53Trihelix family protein