PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g017220m
Common NameCISIN_1g011572mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family VOZ
Protein Properties Length: 376aa    MW: 41823.9 Da    PI: 6.152
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g017220mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ406.84.3e-125983141217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                        pppsaf+gpkcalwdctrpa gse ++dycs+fhatla+ e++pg+tpvlrp+gi+lkd+llf+a++a++qgk vgip+cegaat+kspwna
  orange1.1g017220m  98 PPPSAFMGPKCALWDCTRPALGSELFEDYCSNFHATLAVSEDSPGLTPVLRPGGINLKDSLLFNAVNARAQGKRVGIPHCEGAATTKSPWNA 189
                        89****************************************************************************************** PP

                VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyr 184
                        +elfdl+llegetirewlffdk r+afesg rkqrslpd+sgrgwhesrk vmkefgg+krsyymdpqps+ +ewhlyeyei  +da+alyr
  orange1.1g017220m 190 TELFDLALLEGETIREWLFFDKHRKAFESGTRKQRSLPDHSGRGWHESRKLVMKEFGGQKRSYYMDPQPSDGLEWHLYEYEIIGFDAYALYR 281
                        ******************************************************************************************** PP

                VOZ 185 lelklvdekksakgkvskdsladlqkklgrlta 217
                        le+kl+ ekks+k kv+kdsladlqkk+grlta
  orange1.1g017220m 282 LEVKLASEKKSPKVKVTKDSLADLQKKMGRLTA 314
                        *******************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MKPQPDVQGH PGTMMAFQED YVVNNELQGH CFQGFDKCED SASGLHNPTV GISGLTTQLD  60
YSHLIFRQEL ENLLLDGVNG TEECEKDIGP NSLPIIHPPP SAFMGPKCAL WDCTRPALGS  120
ELFEDYCSNF HATLAVSEDS PGLTPVLRPG GINLKDSLLF NAVNARAQGK RVGIPHCEGA  180
ATTKSPWNAT ELFDLALLEG ETIREWLFFD KHRKAFESGT RKQRSLPDHS GRGWHESRKL  240
VMKEFGGQKR SYYMDPQPSD GLEWHLYEYE IIGFDAYALY RLEVKLASEK KSPKVKVTKD  300
SLADLQKKMG RLTADVPVDN KSSFKGKIET NGKVDSANVN SSQNEMTSAT EILHHGSSSP  360
YKYLADNSAD YYHKY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.100300.0flower| fruit| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446732.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-124VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067DW120.0A0A067DW12_CITSI; Uncharacterized protein
TrEMBLA0A067E3E40.0A0A067E3E4_CITSI; Uncharacterized protein
STRINGXP_006446732.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-127vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]