PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g016782m
Common NameCISIN_1g015940mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 384aa    MW: 43253.4 Da    PI: 6.2644
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g016782mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.47.8e-2881162286
           trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        W ++e++ Li++rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk+k+++++     s +++y+++++
  orange1.1g016782m  81 WVQDETRILIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKTKHQDRGS---GSAKMSYYKEID 162
                        ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-572142IPR009057Homeodomain-like
PROSITE profilePS500908.50273137IPR017877Myb-like domain
SMARTSM007171.3E-577139IPR001005SANT/Myb domain
SuperFamilySSF466894.36E-578148IPR009057Homeodomain-like
CDDcd122033.45E-2979144No hitNo description
PfamPF138379.1E-2280164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MYLSEKPRPY LTEKPRPIDY YKDEAVAAAA AAAAAASSRD MIMEVAAASN GELQPQQMIL  60
ADSSGGEDHE VRAPKKRAET WVQDETRILI AFRREMDGLF NTSKSNKHLW EQISAKMREK  120
GFDRSPTMCT DKWRNLLKEF KKTKHQDRGS GSAKMSYYKE IDEILKERSK NAQYKATSVA  180
NSANKVDTFM QFSDKGFDDT SISFGPVEAT GRPTLNLERR LDHDGHPLAI TTADAVAAAG  240
VPPWNWRDPP PGNGGEGQSF GGKVISVKCG DYTRRIGIDG TPDAIKEAIK SAFGIRTKRA  300
FWLEDEDQIV RCIDRDMPVG NYTLHLDEDH ISVHTEDKTF YTEEDYREFL ARHGWTCLRE  360
FDGYRNVDNM DDLRPGAMYR GVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-5175160186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.59060.0flower
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00141DAPTransfer from AT1G13450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438124.10.0trihelix transcription factor GT-1 isoform X2
RefseqXP_006484031.10.0trihelix transcription factor GT-1-like isoform X2
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A067GTM00.0A0A067GTM0_CITSI; Uncharacterized protein
STRINGXP_006438124.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]