PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g016477m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 390aa    MW: 42473.9 Da    PI: 7.9914
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g016477mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.2e-12144188347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  orange1.1g016477m 144 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKY 188
                        8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.546137193IPR017930Myb domain
SuperFamilySSF466894.93E-16139194IPR009057Homeodomain-like
SMARTSM007174.1E-9141191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-10143187IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17143192IPR006447Myb domain, plants
PfamPF002491.0E-10144188IPR001005SANT/Myb domain
CDDcd001671.31E-8144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGSSPGVG GLKLFGVRLT DGSIIKKSAS MGNLSALHYH  60
SSSSAAASPN PDSPLSDHVR DPNHLTDGYL SDDPAHGSGS SNRRCERKKV PCLLARRACA  120
GASLPLAFTF CLHMDVNKRQ IGVPWTEEEH RLFLIGLQKL GKGDWRGIAR NYVMSRTPTQ  180
VASHAQKYFI RQSNATRRKR RSSLFDMVAD DMATDTPPVP EEQVMLPSPL ARESDNTSSQ  240
PSLNLSLSTE FEPMEAVCKE TEKDSEEPVI DLNEFTPMVS SFFPAYMPVP YTYWPHNAAT  300
GEEDKDAGTS GNHPILKPIP ILPKEPVNVD QLVCMSQLSI GETERGLREP SPLSLKLLGE  360
PSRQSAFHAN APVSRSDLSK GKTTPIQAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.18650.0flower| fruit| leaf| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006465688.10.0transcription factor MYBS3
TrEMBLV4SSM00.0V4SSM0_9ROSI; Uncharacterized protein
STRINGXP_006465688.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-100MYB_related family protein