PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g015499m
Common NameCISIN_1g0084581mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 406aa    MW: 44249.9 Da    PI: 6.9007
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g015499mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.2e-3259116260
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  orange1.1g015499m  59 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 116
                        8****************************************.***************85 PP

2WRKY106.91e-33220278159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  orange1.1g015499m 220 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 278
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182904.58E-2556117IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-2756117IPR003657WRKY domain
SMARTSM007744.1E-3458116IPR003657WRKY domain
PROSITE profilePS5081122.79159117IPR003657WRKY domain
PfamPF031061.0E-2459115IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.5E-38205280IPR003657WRKY domain
SuperFamilySSF1182901.31E-29212280IPR003657WRKY domain
PROSITE profilePS5081138.825215280IPR003657WRKY domain
SMARTSM007743.1E-39220279IPR003657WRKY domain
PfamPF031062.1E-26221278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MTVSSNELSL LGPIQMATTG TIVPAEVDSD EPKQMGQPTA GIQASHSDHK GGGPSMPSDD  60
GYNWRKYGQK HVKGSEFPRS YYKCTHPNCE VKKLFERSHD GQITEIIYKG THDHPKPQLS  120
RRYSAGNMMS IQEERPDKVS SLTCRDGSMY GQMSHAMETN GTPDLSPVAN DDSVEPDVDD  180
DDQYSKRRKM DALVADVTPV VKPIREPRVV VQTLSEVDIL DDGYRWRKYG QKVVRGNPNP  240
RSYYKCTNAG CPVRKHVERA SHDPKAVITT YEGKHNHDVP TARTSSHDAA GPSAGNGPCR  300
IISEEGEAIS LDLGVGISSA TENRSNEQPQ ALHSELAHSH PHASSSSYKI IQANAVTAYS  360
GVVNGGMNQY GSRGNPTEGR GVDFPPLNHS SYPYPQNIGR ILTGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-3759280877Probable WRKY transcription factor 4
2lex_A4e-3759280877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.112740.0callus| flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4392741e-73AF439274.3 Retama raetam WRKY-like drought-induced protein (WRK) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474948.10.0probable WRKY transcription factor 20
SwissprotQ93WV01e-151WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A067F4C10.0A0A067F4C1_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006474948.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-146WRKY family protein