PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g014731m
Common NameCISIN_1g014629mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 420aa    MW: 46350.4 Da    PI: 7.8145
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g014731mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054e-33188244360
                        -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  orange1.1g014731m 188 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 244
                        9***************************************.***************85 PP

2WRKY34.25e-11386406222
                        --SS-EEEEEEE--TT-SS-E CS
               WRKY   2 dDgynWrKYGqKevkgsefpr 22 
                        +Dg++WrKYGqK+vkg+++pr
  orange1.1g014731m 386 SDGFRWRKYGQKVVKGNPYPR 406
                        7*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-29184245IPR003657WRKY domain
SuperFamilySSF1182902.22E-26185245IPR003657WRKY domain
SMARTSM007743.2E-37186244IPR003657WRKY domain
PfamPF031069.5E-26188243IPR003657WRKY domain
PROSITE profilePS5081124.122188245IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-11371406IPR003657WRKY domain
SuperFamilySSF1182901.12E-8379407IPR003657WRKY domain
PROSITE profilePS5081114.722380419IPR003657WRKY domain
SMARTSM007741.3E-4385417IPR003657WRKY domain
PfamPF031067.7E-7387406IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MKIKEAERIV VAKPVPSRPT RSTFGSFSEL LEGPIHASPP NVCSETAVMA IRPKTVRFKP  60
LVNCAPPNQT ELARTAVCNS SDDVSKSDNK PTVIYKPLAR LVSRTTVSLL ENMGNFDTSH  120
QHTQQSVEAQ HPSQDKQNFI SQISSNSNQV LPPLKEKDQT IESFREASQN LEDPKYFPPV  180
AGDRPSYDGY NWRKYGQKQV KGSEYPRSYY KCTHPNCPVK KKVERSFDGQ IAEIVYKGEH  240
NHPKPQPPKR SSSVTQGLGL GSDGTGQDTN NTVWNTHLSE INEGSDGRVV NQNDLGVLAD  300
STCQAKPLPP FIPVSTGANN TDGGTSDNSC GISGEFDEGR KTLEGEDEQP RKRRSDHQSN  360
EPGLSEDSIL EPRIVVQSST DSEILSDGFR WRKYGQKVVK GNPYPRLRLD NNLTSNITS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-181882451674WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024955701.10.0WRKY transcription factor 44 isoform X3
TrEMBLA0A067EDE80.0A0A067EDE8_CITSI; Uncharacterized protein
STRINGXP_006480560.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.13e-80WRKY family protein