PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g014693m
Common NameCISIN_1g014693mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GeBP
Protein Properties Length: 421aa    MW: 45926.5 Da    PI: 4.3827
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g014693mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.96.2e-38123218297
             DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                        lfqrlw++eDei lLqG++d+++++g   ++d+  fy+++k++++++++k+qlveK+rrLKkK+++  +k+ sgk++sf+++hdq +fe+s+
  orange1.1g014693m 123 LFQRLWTDEDEIELLQGFLDYTTQRGNAHHHDTALFYDQIKSKLQLDFNKNQLVEKLRRLKKKYRNVINKITSGKDFSFKTAHDQATFEISR 214
                        79****************************************************************************************** PP

             DUF573  94 kiWg 97 
                        kiW 
  orange1.1g014693m 215 KIWS 218
                        ***7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-34124218IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MASEQHDTVL PEEDQDLEED EESSEEDDLE ENDDVLPDEE EEDDEEDLNS ASTAAVPSAA  60
AAETPTVTVA FPSSSASAAT VTLALPPAAI DETDPKRQRV AESVTVHEEK KPLPQQLDES  120
RRLFQRLWTD EDEIELLQGF LDYTTQRGNA HHHDTALFYD QIKSKLQLDF NKNQLVEKLR  180
RLKKKYRNVI NKITSGKDFS FKTAHDQATF EISRKIWSST PNVSVLDDED ANNSNNHLVI  240
SHEMRNNNNN NSNYNNNYGF VGGNANEEKV TPRPRKRSRS KAGGNDNVSA GTMNNCENMN  300
VNSGGGVGGG SGIAGVVEET VRSCLSPLFR ELLSNVMGGM GGRGIGGLAM NAIMPMGFGG  360
AGIGMGMMGF GGSGVGGGSE VVDEKWRKQQ ILELEVYSKR LELVQDQIKV ALEELRSMGG  420
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471737.10.0PREDICTED: uncharacterized SDCCAG3 family protein
TrEMBLA0A067EQU30.0A0A067EQU3_CITSI; Uncharacterized protein
STRINGGLYMA19G43180.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30982764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.17e-69DNA-binding storekeeper protein-related transcriptional regulator