PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g013140m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 450aa    MW: 50450.4 Da    PI: 9.793
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g013140mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.7e-07130171446
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT+eE ++l ++++++  + +  Ia +++  Rt +++k+r++ 
  orange1.1g013140m 130 WTKEETDQLFELCERFDLR-FIVIADRFPSSRTVEELKDRYYV 171
                        *******************.*********************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162827.7E-29102171IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007172.9E-5126175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-5129170IPR009057Homeodomain-like
SuperFamilySSF466891.95E-6129172IPR009057Homeodomain-like
CDDcd116582.48E-18130170No hitNo description
PfamPF054995.9E-7319381IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MDAKDILGIP KTQLPTTQEK KSRPQKEPQR KPDGISREVY ALTGGLAPLM PSIDVSQLKK  60
RPPSDEKITW QWLPFTNSAR KDNLQLYHWV RVVNGVPPTG DYSFAKYNKS VDVVKYTDEE  120
YEKYLTDPMW TKEETDQLFE LCERFDLRFI VIADRFPSSR TVEELKDRYY VSRAILIARA  180
PSPTDVSGHP LVKDPYNVSQ EVERKRALSM VLSQTKHQER KDAEVLAEAK RITDSRMASR  240
AAEEPEMPVA SHVGSESADR AVVLGDTVSP SSNIQLPSAT VVPSTSIIAD SASTLASLRM  300
LRVYLRTYAL EQMVQAASSS AGLRTIKRVE QALQELGVNL KPKVPTKAVC AEHLELRKEI  360
LTLLNLQKQL QYKEAEGSSY RDGSYIDMPG TPKRSQRAGD QDRTFVPESI NFGGERVGKR  420
DQKRKGPGRL SEAPSSPAHK RPRKKASDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A6e-20101185493DNA methyltransferase 1-associated protein 1
4iej_A6e-20101185493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492373.10.0SWR1-complex protein 4 isoform X2
RefseqXP_024043722.10.0SWR1-complex protein 4 isoform X2
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLV4U6K60.0V4U6K6_9ROSI; Uncharacterized protein
STRINGXP_006492372.10.0(Citrus sinensis)
STRINGXP_006444556.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]