PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g012625m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 460aa    MW: 51117.9 Da    PI: 8.3627
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g012625mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-1660104147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  orange1.1g012625m  60 RERWTEEEHKKFLEALKLFGRA-WRKIEEHVG-TKTAVQIRSHAQKF 104
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1754108IPR009057Homeodomain-like
PROSITE profilePS5129421.19355109IPR017930Myb domain
TIGRFAMsTIGR015577.4E-1758107IPR006447Myb domain, plants
SMARTSM007173.7E-1359107IPR001005SANT/Myb domain
PfamPF002496.2E-1460103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-960100IPR009057Homeodomain-like
CDDcd001672.53E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MAVQDECGGN HSNSVFSAGN GIESSSGLHT VTGLEVKDQF SCGNDFAPKP RKPYTITKQR  60
ERWTEEEHKK FLEALKLFGR AWRKIEEHVG TKTAVQIRSH AQKFFSKVVR ESNGCSTSPV  120
EPVEIPPPRP KRKPMHPYPR KLAHPPVKES LNPELSRTSL SPILSVSERE NQSPTSVLFA  180
IGSDAFGSSD SNSPNGSLSP VSSAVPEQLG GLTLSHPSSS PEERGSPSSD PVTPGSVTDE  240
QSPKCVLKMG LSPQRFDKEV SDGLVNYLNH FLPRLLRVNL CSYCRWRLCI PNHCLRTQNM  300
HGDVPCHMEG LGLSVVCNRQ MMTQIWWILV LVLIFHGGIS LMVCHMLSLQ IISSVKEVQG  360
REFKKEGSLT GSNSKSVNEE DSIDKSSDVD SQSSRQSLDK EDKWLEVAFE LKPSENSAFS  420
VIRTRTDKHM KGFVPYKKRI VERDNQLSAV GNGRDQREW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.55811e-178flower| fruit| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430409.10.0protein REVEILLE 1
TrEMBLA0A067F1F20.0A0A067F1F2_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006430409.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-45MYB_related family protein