PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011834m
Common NameCISIN_1g011471mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family VOZ
Protein Properties Length: 477aa    MW: 52989.5 Da    PI: 5.777
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011834mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ442.64.8e-1361994151217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                        pppsaflgpkcalwdc+rpaqg++w+qdycs fha+la+ eg+pg+ pvlrp+gi+lkdgllfaalsa++qgk+vgipecegaatakspwna
  orange1.1g011834m 199 PPPSAFLGPKCALWDCPRPAQGVDWYQDYCSGFHAALAFSEGPPGMGPVLRPGGIGLKDGLLFAALSARAQGKDVGIPECEGAATAKSPWNA 290
                        89****************************************************************************************** PP

                VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyr 184
                        +elfdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyr
  orange1.1g011834m 291 PELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYR 382
                        ******************************************************************************************** PP

                VOZ 185 lelklvdekksakgkvskdsladlqkklgrlta 217
                        lelklvd+kksakgk+++ds+adlqk++grlta
  orange1.1g011834m 383 LELKLVDGKKSAKGKLANDSVADLQKQMGRLTA 415
                        *******************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MVGKGAKTNC KSASHKLFKD KAKTRVDDLQ GKFLDLQFAR KESRTVDVSL LEEQVHQMLR  60
EWKAELHEPS PASSLQQDGS LGFSSDIYRL LQLCEEEDDA TSTLTAPKPE PNDQVLPVAD  120
TAVYHEQHSF PLVDQCKNSS SGVHSTAINN LEGSTLLDYH HFDLHQEFEQ NFYAGYNVSN  180
FCGEDAMQQI SGYLPGICPP PSAFLGPKCA LWDCPRPAQG VDWYQDYCSG FHAALAFSEG  240
PPGMGPVLRP GGIGLKDGLL FAALSARAQG KDVGIPECEG AATAKSPWNA PELFDLSVLE  300
GETIREWLFF DKPRRAFESG NRKQRSLPDY SGRGWHESRK QVMNEFGGLK RSYYMDPQPL  360
NHFEWHLYEY EINKCDACAL YRLELKLVDG KKSAKGKLAN DSVADLQKQM GRLTAEFPSD  420
NKRLVKGRAK VNAKAGVGGN IYPASNVVAS TNEKFDYGPT GQFDYLIENL SEYYLT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467712.10.0transcription factor VOZ1 isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067GQQ90.0A0A067GQQ9_CITSI; Uncharacterized protein
STRINGXP_006467710.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]