PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011572m
Common NameCISIN_1g011572mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family VOZ
Protein Properties Length: 484aa    MW: 53504.9 Da    PI: 5.6026
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011572mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ405.98.2e-1252064221217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                        pppsaf+gpkcalwdctrpa gse ++dycs+fhatla+ e++pg+tpvlrp+gi+lkd+llf+a++a++qgk vgip+cegaat+kspwna
  orange1.1g011572m 206 PPPSAFMGPKCALWDCTRPALGSELFEDYCSNFHATLAVSEDSPGLTPVLRPGGINLKDSLLFNAVNARAQGKRVGIPHCEGAATTKSPWNA 297
                        89****************************************************************************************** PP

                VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyr 184
                        +elfdl+llegetirewlffdk r+afesg rkqrslpd+sgrgwhesrk vmkefgg+krsyymdpqps+ +ewhlyeyei  +da+alyr
  orange1.1g011572m 298 TELFDLALLEGETIREWLFFDKHRKAFESGTRKQRSLPDHSGRGWHESRKLVMKEFGGQKRSYYMDPQPSDGLEWHLYEYEIIGFDAYALYR 389
                        ******************************************************************************************** PP

                VOZ 185 lelklvdekksakgkvskdsladlqkklgrlta 217
                        le+kl+ ekks+k kv+kdsladlqkk+grlta
  orange1.1g011572m 390 LEVKLASEKKSPKVKVTKDSLADLQKKMGRLTA 422
                        *******************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MQSGSKSKCA SASHQFLLDS AKNRLNDLQE KFANLRVARK EGRANDVAVL EEQVNQILRE  60
WNSELSAPSP ASSLLGGSLG LFPNDIDRLL QLGDEQDDAT SPLAGFAEMK PQPDVQGHPG  120
TMMAFQEDYV VNNELQGHCF QGFDKCEDSA SGLHNPTVGI SGLTTQLDYS HLIFRQELEN  180
LLLDGVNGTE ECEKDIGPNS LPIIHPPPSA FMGPKCALWD CTRPALGSEL FEDYCSNFHA  240
TLAVSEDSPG LTPVLRPGGI NLKDSLLFNA VNARAQGKRV GIPHCEGAAT TKSPWNATEL  300
FDLALLEGET IREWLFFDKH RKAFESGTRK QRSLPDHSGR GWHESRKLVM KEFGGQKRSY  360
YMDPQPSDGL EWHLYEYEII GFDAYALYRL EVKLASEKKS PKVKVTKDSL ADLQKKMGRL  420
TADVPVDNKS SFKGKIETNG KVDSANVNSS QNEMTSATEI LHHGSSSPYK YLADNSADYY  480
HKY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.100300.0flower| fruit| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446732.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-168VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067DW120.0A0A067DW12_CITSI; Uncharacterized protein
STRINGXP_006446732.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-159vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]