PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011340m
Common NameCISIN_1g011340mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 489aa    MW: 53282.5 Da    PI: 6.9234
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011340mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY863.4e-2798155260
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        +DgynWrKYGqK v+g+ef rsYY+Ct+++C +kk++++++ ++++v+++Y+g+H h+k
  orange1.1g011340m  98 EDGYNWRKYGQKLVRGNEFVRSYYKCTHPRCLAKKQLDCTH-EGQIVDTIYSGDHCHPK 155
                        7**************************************99.***************85 PP

2WRKY1047.9e-33269327159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ++Dgy+WrKYGqK vkg+++pr+YYrC+ +gCp+kk+ver+++dpk+v++tYeg+H+h+
  orange1.1g011340m 269 VNDGYRWRKYGQKLVKGNPNPRNYYRCSNSGCPAKKHVERASHDPKLVITTYEGRHDHD 327
                        58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-2390155IPR003657WRKY domain
PROSITE profilePS5081119.04992156IPR003657WRKY domain
SuperFamilySSF1182905.23E-2193155IPR003657WRKY domain
SMARTSM007741.4E-2797155IPR003657WRKY domain
PfamPF031062.9E-2098154IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-34257329IPR003657WRKY domain
SuperFamilySSF1182903.27E-29261329IPR003657WRKY domain
PROSITE profilePS5081135.622264329IPR003657WRKY domain
SMARTSM007743.0E-38269328IPR003657WRKY domain
PfamPF031062.9E-26270326IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MVSSGEDGLD EVASDKLQHE PGPVSETHAL QSDQGFSTPI LSRKSLMLPD TGHLLPSDQE  60
RSISSITSEK ASQTTDIIPA LQTGQEVSTP TIREKVSEDG YNWRKYGQKL VRGNEFVRSY  120
YKCTHPRCLA KKQLDCTHEG QIVDTIYSGD HCHPKVPNVP LAVGIVVSVV EEKPEVSSIS  180
SAKDKSSDTH GQTPRQTERN DNSRLSVAAA SGGMKDPLIS NRMKDEVDND DRPGSKRRKK  240
DHFNANASPV EKLTGEHRVV QTLSEVDFVN DGYRWRKYGQ KLVKGNPNPR NYYRCSNSGC  300
PAKKHVERAS HDPKLVITTY EGRHDHDMPP SRTVTPNVAG TKNSKTAHNG ESAKLEEIDA  360
VCSDTDVHRS SDTLSKSTEG KNGEPKTKSE ATATASVGLV KSEQSAVHPE SKSSEPQNGN  420
SRTIEGSDVA HGRSCHKGSS NDQSNCESET KSEQNGTACR DKVIQATSLP DANYGEQEQT  480
PKAEAVRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-34259330475WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.68620.0flower| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed to similar levels in root and flower, to a somewhat lower level in stem and to low levels in leaf and siliques. {ECO:0000269|PubMed:8972846}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447745.10.0WRKY transcription factor 1
RefseqXP_006469519.10.0WRKY transcription factor 1
SwissprotQ9SI376e-83WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A067F5F00.0A0A067F5F0_CITSI; Uncharacterized protein
STRINGXP_006469519.10.0(Citrus sinensis)
STRINGXP_006447745.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.22e-84zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]