PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g010935m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 498aa    MW: 55967.8 Da    PI: 6.4642
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g010935mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.74.2e-11143184446
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        W ++++ ll+++++++G g+W+ Ia+++g ++t + c++++ +
  orange1.1g010935m 143 WNADDEILLLEGIEMYGLGNWAEIAEHVG-TKTKELCIEHYTN 184
                        *****************************.***********88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250241.0E-13670494IPR016827Transcriptional adaptor 2
SMARTSM002912.0E-1279124IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013511.20679126IPR000433Zinc finger, ZZ-type
PfamPF005694.7E-1082123IPR000433Zinc finger, ZZ-type
SuperFamilySSF578507.18E-1583145No hitNo description
CDDcd023356.44E-2783131No hitNo description
PROSITE patternPS01357085112IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.74E-12136189IPR009057Homeodomain-like
PROSITE profilePS5129321.262138190IPR017884SANT domain
SMARTSM007173.4E-10139188IPR001005SANT/Myb domain
PfamPF002491.4E-10142184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-7143185IPR009057Homeodomain-like
CDDcd001673.84E-11143185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MPVSLSVVLV VAFQEILTFA SKQALVIVSS LNFEKNMGRS RGNFHANDED PTQRSRRKKN  60
VSSDNSDTAA PGQGAGEGKR ALYHCNYCNK DITGKIRIKC AVCPDFDLCI ECFSVGVEVH  120
PHKSNHPYRV MDNLSFPLIC PDWNADDEIL LLEGIEMYGL GNWAEIAEHV GTKTKELCIE  180
HYTNVYMNSP FFPLPDMSHV VGKNRKELLA MAKGHIDDKK GPSKPGEATV KEESPFSPSR  240
VKIEEMHKVG PSGRGLNADP QTERSSKGKK PVTSGNDGPS LVELSGYNSK RQEFDPEYDN  300
DAEQLLAEME FKDADSEEER DIKLRVLRIY SKRLDERKRR KDFILERNLL YPNPFEKDLS  360
PEERELCRRY DVFMRFHSKE DHEDLLQTVI SEHRTLKRIQ DLKEARAAGC RTSAEADRYL  420
ELKRGREAEE ASRRAKEGGH AGASSQGGAN VFMASESLRK DSNSNSRPSG QASSSHVNDL  480
YIMGFNETQL LSEAVSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6cw2_C2e-40831985120Transcriptional adapter 2
6cw3_E2e-40831985120Transcriptional adapter 2
6cw3_G2e-40831985120Transcriptional adapter 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1336341RKRRKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.91130.0callus| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, flowers and siliques, with the strongest activity in the meristematic zones. {ECO:0000269|PubMed:11266554, ECO:0000269|PubMed:12747832}.
Functional Description ? help Back to Top
Source Description
UniProtRequired for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region. Mediates auxin and cytokinin signals in the control of cell proliferation and might be involved in repression of a freezing tolerance pathway at warm temperature (PubMed:12615937, PubMed:12747832). Involved in the positive regulation of salt-induced gene expression by maintaining locus-specific acetylation of histones H4 and H3 (PubMed:21193996). {ECO:0000250, ECO:0000269|PubMed:12615937, ECO:0000269|PubMed:12747832, ECO:0000269|PubMed:21193996}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467294.10.0transcriptional adapter ADA2b isoform X2
SwissprotQ9ATB40.0TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLV4ULF30.0V4ULF3_9ROSI; Transcriptional adapter
STRINGXP_006467294.10.0(Citrus sinensis)
Publications ? help Back to Top
  1. Vlachonasios KE,Thomashow MF,Triezenberg SJ
    Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression.
    Plant Cell, 2003. 15(3): p. 626-38
    [PMID:12615937]
  2. Sieberer T,Hauser MT,Seifert GJ,Luschnig C
    PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation.
    Curr. Biol., 2003. 13(10): p. 837-42
    [PMID:12747832]
  3. Kerschen A,Napoli CA,Jorgensen RA,Müller AE
    Effectiveness of RNA interference in transgenic plants.
    FEBS Lett., 2004. 566(1-3): p. 223-8
    [PMID:15147899]
  4. Hark AT, et al.
    Two Arabidopsis orthologs of the transcriptional coactivator ADA2 have distinct biological functions.
    Biochim. Biophys. Acta, 2009. 1789(2): p. 117-24
    [PMID:18929690]
  5. Anzola JM, et al.
    Putative Arabidopsis transcriptional adaptor protein (PROPORZ1) is required to modulate histone acetylation in response to auxin.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10308-13
    [PMID:20479223]
  6. Kaldis A,Tsementzi D,Tanriverdi O,Vlachonasios KE
    Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses.
    Planta, 2011. 233(4): p. 749-62
    [PMID:21193996]
  7. Vlachonasios KE,Kaldis A,Nikoloudi A,Tsementzi D
    The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses.
    Plant Signal Behav, 2011. 6(10): p. 1475-8
    [PMID:21897124]
  8. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  9. Kazama D,Kurusu T,Mitsuda N,Ohme-Takagi M,Tada Y
    Involvement of elevated proline accumulation in enhanced osmotic stress tolerance in Arabidopsis conferred by chimeric repressor gene silencing technology.
    Plant Signal Behav, 2014. 9(3): p. e28211
    [PMID:24614501]
  10. Kim JY,Oh JE,Noh YS,Noh B
    Epigenetic control of juvenile-to-adult phase transition by the Arabidopsis SAGA-like complex.
    Plant J., 2015. 83(3): p. 537-45
    [PMID:26095998]
  11. Kazama D, et al.
    Identification of Chimeric Repressors that Confer Salt and Osmotic Stress Tolerance in Arabidopsis.
    Plants (Basel), 2013. 2(4): p. 769-85
    [PMID:27137403]
  12. Simon MK,Skinner DJ,Gallagher TL,Gasser CS
    Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors.
    Genetics, 2017. 207(4): p. 1489-1500
    [PMID:28971961]
  13. Lai J, et al.
    The Transcriptional Coactivator ADA2b Recruits a Structural Maintenance Protein to Double-Strand Breaks during DNA Repair in Plants.
    Plant Physiol., 2018. 176(4): p. 2613-2622
    [PMID:29463775]
  14. Kotak J, et al.
    The histone acetyltransferase GCN5 and the transcriptional coactivator ADA2b affect leaf development and trichome morphogenesis in Arabidopsis.
    Planta, 2018. 248(3): p. 613-628
    [PMID:29846775]