PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g010802m
Common NameCISIN_1g010802mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 502aa    MW: 55250.6 Da    PI: 7.3419
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g010802mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.26e-32223280260
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        dDgynWrKYGqK++kg+e+prsYY+Ct+ +Cpvkkkvers+ + ++++i+Y++eHnhek
  orange1.1g010802m 223 DDGYNWRKYGQKPIKGNEYPRSYYKCTHVNCPVKKKVERSS-NAQITQIIYKNEHNHEK 280
                        8****************************************.***************85 PP

2WRKY105.82.2e-33391449159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+ +dpk+v++tYeg+Hnh+
  orange1.1g010802m 391 LDDGYRWRKYGQKVVKGNPHPRSYYKCTNPGCNVRKHVERAPTDPKAVVTTYEGKHNHD 449
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.7E-29217282IPR003657WRKY domain
PROSITE profilePS5081124.616217281IPR003657WRKY domain
SuperFamilySSF1182901.11E-25220281IPR003657WRKY domain
SMARTSM007742.7E-36222280IPR003657WRKY domain
PfamPF031063.8E-25223279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36376451IPR003657WRKY domain
SuperFamilySSF1182901.7E-29383451IPR003657WRKY domain
PROSITE profilePS5081138.17386451IPR003657WRKY domain
SMARTSM007741.2E-39391450IPR003657WRKY domain
PfamPF031064.8E-26392449IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MASGKEHLTQ KKRPTIILPP RPSMESLYGS GLSPGPMTLV SSFFAEDLNN QSFSQLLAGA  60
MASPLASKQA QSFLVDYSKD GDGDGDDKSY GFKENRPTSL MIARSPLFTV PPGLSPSGLL  120
NSPGFFSPQS PFGMSHQQAL ATVTAQAFLA QSSMHKQAEY QPSLLSAPEE SLTCNLSVTP  180
DEPSQQQMPH SNSAPQSSMT EPLEVSHSDG KHMHPSAVDK PADDGYNWRK YGQKPIKGNE  240
YPRSYYKCTH VNCPVKKKVE RSSNAQITQI IYKNEHNHEK PQLSKRAKDS SDANENNNSQ  300
ANPEPVLHGQ TLYASSVLGS NQESAQAAPI HLADSSDSEE LGDAENRKEG DDDEPNTKRR  360
NIAVESEIVL SQKTVTEPKI IVQTRSEVDL LDDGYRWRKY GQKVVKGNPH PRSYYKCTNP  420
GCNVRKHVER APTDPKAVVT TYEGKHNHDV PAAKNGSHSA PPRLKPNKVV TEKHPLLKDM  480
DFGHDDQRPV LLRLKEEQII V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-41223452878Probable WRKY transcription factor 4
2lex_A1e-41223452878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.11170.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8276481e-77KT827648.1 Manihot esculenta WRKY transcription factor 73 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482724.10.0probable WRKY transcription factor 4 isoform X1
SwissprotQ9XI901e-143WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A067FZC20.0A0A067FZC2_CITSI; Uncharacterized protein
STRINGXP_006482724.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-142WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]