PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g009174m
Common NameCISIN_1g009174mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 542aa    MW: 61853.6 Da    PI: 6.2312
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g009174mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix101.85.3e-32388472186
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        rW+k ev aLi++r  +e+r+ +  lk+plWeevs+ m++ g++rs+k+Ckekwen+nk+++k+ke+ kkr s++s+tcpyfdql+
  orange1.1g009174m 388 RWPKTEVEALIQVRGGLESRFLEPGLKGPLWEEVSALMASMGYQRSAKRCKEKWENINKYFRKTKESGKKR-SPQSKTCPYFDQLD 472
                        8*********************************************************************8.67778********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.957381445IPR017877Myb-like domain
PfamPF138371.6E-22387474No hitNo description
CDDcd122031.99E-28387452No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQSGYGASEI HQHHQNLIGD AGDDVDGCCP SIFTISNPPE NNHLYYRHPR QHEKHPQQQQ  60
QMFQPPPPPP SPFTHRLLRP FQTLIHQPQP QQQQGERLHS QLGLEVQDPC PTSLHPFFDV  120
NFKLGLNENS GNNGSKHEIT TLLHGNEQQQ HHNHQSLVMP PHSWHSQEDS SAIKLQEPFW  180
KPGVVDKDQP ENIKKHHVMG SKYQHFGGEL EAIYGLANAK INVETDNQIT GSGSAIIGVN  240
DLDHGSENSI GEEKLAHEKK KRKRKMKEKL SSMFGFFEGL VKQVMDHQEG LHRKFVEVVQ  300
RMDREKSERE EAWRREDAAK YNREAIARAH EQAAALSREA LIISHLEKIT GQSINLPPRK  360
TALLLVQPDQ VITKGPTKEW KSDMISRRWP KTEVEALIQV RGGLESRFLE PGLKGPLWEE  420
VSALMASMGY QRSAKRCKEK WENINKYFRK TKESGKKRSP QSKTCPYFDQ LDQLYSRNNP  480
INIPADPDMG VQNQGYSELL EAFAAASDHG NENENHEYDH NDDDDEDEDE DRDDDAEENG  540
D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258264KKKRKRK
2258265KKKRKRKM
3259264KKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5731490.0AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015384478.10.0trihelix transcription factor GT-2-like
TrEMBLA0A067GDN70.0A0A067GDN7_CITSI; Uncharacterized protein
STRINGXP_006453007.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-41Trihelix family protein