PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g008501m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 564aa    MW: 60913.6 Da    PI: 6.9495
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g008501mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.7e-32217274260
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  orange1.1g008501m 217 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 274
                        8****************************************.***************85 PP

2WRKY106.31.6e-33378436159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  orange1.1g008501m 378 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 436
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182907.45E-25214275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.8E-27214275IPR003657WRKY domain
SMARTSM007744.1E-34216274IPR003657WRKY domain
PfamPF031061.7E-24217273IPR003657WRKY domain
PROSITE profilePS5081122.791217275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-37363438IPR003657WRKY domain
SuperFamilySSF1182902.22E-29370438IPR003657WRKY domain
PROSITE profilePS5081138.825373438IPR003657WRKY domain
SMARTSM007743.1E-39378437IPR003657WRKY domain
PfamPF031063.4E-26379436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MEDTEVRVGD VADRTRGADV ASASGAGGGG ARYKLMSPAK LPISRSPCIM IPPGLSPSSF  60
LESPVLLSNV KAEPSPTTGS FFKPQAVHAS VGPRTYSTTT VCSNTLNEGE ASCFEFRPHS  120
RSNMVPADLN PQRSEQYVQT QGQCQTQSFA SSPTIKGEMT VSSNELSLLG PIQMATTGTI  180
VPAEVDSDEP KQMGQPTAGI QASHSDHKGG GPSMPSDDGY NWRKYGQKHV KGSEFPRSYY  240
KCTHPNCEVK KLFERSHDGQ ITEIIYKGTH DHPKPQLSRR YSAGNMMSIQ EERPDKVSSL  300
TCRDGSMYGQ MSHAMETNGT PDLSPVANDD SVEPDVDDDD QYSKRRKMDA LVADVTPVVK  360
PIREPRVVVQ TLSEVDILDD GYRWRKYGQK VVRGNPNPRS YYKCTNAGCP VRKHVERASH  420
DPKAVITTYE GKHNHDVPTA RTSSHDAAGP SAGNGPCRII SEEGEAISLD LGVGISSATE  480
NRSNEQPQAL HSELAHSHPH ASSSSYKIIQ ANAVTAYSGV VNGGMNQYGS RGNPTEGRGV  540
DFPPLNHSSY PYPQNIGRIL TGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36217438877Probable WRKY transcription factor 4
2lex_A2e-36217438877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.112740.0callus| flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4392742e-73AF439274.3 Retama raetam WRKY-like drought-induced protein (WRK) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474948.10.0probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A2H5PR580.0A0A2H5PR58_CITUN; Uncharacterized protein
STRINGXP_006474948.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein