PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g007469m
Common NameCISIN_1g007469mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 603aa    MW: 64367.2 Da    PI: 8.2799
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g007469mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14112151242
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                        ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e+
  orange1.1g007469m 112 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCHNNVEN 151
                        89**************************.********9875 PP

2TCR51.22.5e-16196235140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  orange1.1g007469m 196 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCMDCKNFE 235
                        589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-17111151IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.712112236IPR005172CRC domain
PfamPF036381.2E-11113148IPR005172CRC domain
SMARTSM011141.0E-19196237IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12199234IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MGEGEGGEFP PKKSQSESGG DIPAKKLARQ LDFTGGFVGS VILPEHPQSQ AVTANSHPPP  60
QPQPKPVVPP VPPPPPPLPG QATQPPVRVP KPESPKSRSR SNVEVKENTP KKQKQCNCKH  120
SRCLKLYCEC FASGIYCDGC NCVNCHNNVE NEAARREAVE ATLERNPNAF RPKIASSPHG  180
TRDNKEETGE VLMLGKHNKG CHCKKSGCLK KYCECFQANI LCSENCRCMD CKNFEGSEER  240
QALFHGDHAN NMAYIQQAAN AAITGAIGSS GYASPPVSKK RKGQELFFGS TAKDPSIHRL  300
GHFQQGNHIR TSPSSTLSSI PVARASSTAA VGSSKFTYRS LLADIIQPQD LKELCSVLVV  360
LSSEAAKSVA VQRNTTEKQA EDRAGTSVAS SAQGRLQSHK EPDVDRTVTD DCSSANQADK  420
VGPDDSGSDG SDGQKARPMS PGTLALMCDE QDTIFMAASS PNRLTGHGCN TSSQLPYGQG  480
MTEVYAEQER IVLTKFRDCL NRLITFGEIK EMKYSSLART EVGSQKDALS NGTASSRTGT  540
GNQPATVSNG VSKAYGPSAL AAPAAKMSQM VTATVPISNN DLRHNPALPG EGDVKLKTEN  600
KM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-311042452132Protein lin-54 homolog
5fd3_B1e-311042452132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142824e-99AC214282.1 Populus trichocarpa clone POP018-K04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024952904.10.0protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067DUG90.0A0A067DUG9_CITSI; Uncharacterized protein
STRINGXP_006475649.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-175Tesmin/TSO1-like CXC domain-containing protein