PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g006300m
Common NameCISIN_1g006300mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 652aa    MW: 71543.7 Da    PI: 5.8027
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g006300mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.81.4e-15483520340
                TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +k+CnCk+skClk+YCeCfaag +C e C+C dC+Nk 
  orange1.1g006300m 483 CKRCNCKRSKCLKLYCECFAAGLYCIEPCSCLDCFNKP 520
                        89**********************************96 PP

2TCR51.61.9e-16567606140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        ++kkgCnCk+s+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  orange1.1g006300m 567 RHKKGCNCKRSSCLKKYCECFQGGVGCSISCRCEGCKNSF 606
                        589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.0E-18481522IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.435482607IPR005172CRC domain
PfamPF036383.7E-11484519IPR005172CRC domain
SMARTSM011141.5E-17567608IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-12569605IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MMLVNMQDSP VFNYISSLSP IEQIKSIRND RSFNSVNFTS PSSLFASPKI GYLRESRFSL  60
SSNQSPDILK PELPLHGKEN KISKGNSEAV QLFDDCTGKL DCVTPGSSAR EVISKLLDET  120
LELAIELPIT VKYDGGTPVR NKVSRDVKEK SREPETDRAS LSFVQCNEDN PGAADYFENK  180
TNLRKICRIE QSEEVAGCDW VSLVSDAVLN SNLSVVENNS EDQDEKTVDT GAISFISTVL  240
QLPQDNTKDL VNMVTGSRSC SCKQSEMTEP LTQPEEIENL KDTDRTPDIL SSTLLDKLIV  300
SDSREKMDNE EEKCGQSSCK HNILRRCLDF EMVGARKKKV ACESNCTSSN LSQADCKDAS  360
IKKHFVPSKS KSSSSSMVAG AGLHLNALAA ASKDGKLVKC KTTASGSKVI SMRICESPCL  420
SLTSCPNLLN KSEERDPVPC GTEVYVVENA MQPSVSVGSE EFNHSSPKRK RYKPEHNVES  480
MACKRCNCKR SKCLKLYCEC FAAGLYCIEP CSCLDCFNKP IHEDKVLETR RQIELRNPLA  540
FAPKVIRSTD STVELGDEAN KTPASARHKK GCNCKRSSCL KKYCECFQGG VGCSISCRCE  600
GCKNSFGRKD VPNFAVFSPL GAEEGEYDGE ESETCAKSES DANIHDNTEG G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1648460412120Protein lin-54 homolog
5fd3_B1e-1648460412120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1466473PKRKRYKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.23370.0callus
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471928.10.0CRC domain-containing protein TSO1 isoform X2
TrEMBLA0A067DFH00.0A0A067DFH0_CITSI; Uncharacterized protein
STRINGXP_006471926.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-81TESMIN/TSO1-like CXC 2