PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005589m
Common NameCISIN_1g0055891mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 690aa    MW: 75837 Da    PI: 4.4659
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005589mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94.1e-12577619246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rW+++E el+++a++q+G++  + I + ++ gRt+ q+k+++ k
  orange1.1g005589m 577 VRWSKQETELFYEAIRQFGTD-LSMIQQLFP-GRTRQQVKLKYKK 619
                        69*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.2E-29569652No hitNo description
PROSITE profilePS5129310.687574625IPR017884SANT domain
SMARTSM007171.9E-9575623IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-7576619IPR009057Homeodomain-like
SuperFamilySSF466897.48E-11578625IPR009057Homeodomain-like
CDDcd001673.79E-8578619No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MDLDTDLFAD ESGPAVNHVR GRFQPKAKPR PRNERTASVD VIDKDSQLLD PVVSSVPASE  60
VVRTVEHFKE NESSENALHS EVTASDGCGD LLSSFQKAAG QNADVLSGLE SLNDFQSQSS  120
NGTEMPALIV SDYNGGEAVV FEGLSSDNNA APGVCDAAQA ETSADMFLTQ DPISCGQAAL  180
TNNAGGIPVD DARLEREVQQ DGAFPDLNFL DSTSEEAVAS GQRAAKYKPR PQVRTESEKF  240
NISSVPHPDA VESVMHSPNA QFVSSGSQFM SEGSIPASVP EDCFDYSSID LDGTTPPDPT  300
SSEFPVNEEL TNFAETSFTD AAASGDMQHE DFPATTESQS AMGKETKAST VLSLSQRLIE  360
SSQAGKETEV GKLLRQLRKG VVVPELVDEP DNEARNDGSF SAEPPSNAVD EDEGDVGGNS  420
AEKTSEKKRA PRKSKETVSE NGKTVRKRKK ANEASDTDKN PPKKFSHSTR RKRRIVNKEL  480
LQTPEDEIDP QKVPMKDLIL LAEYKERLAS KEAKATGTPL KNQSAEHSSR EEDYHNEDET  540
FASEQDNGSF GDPATDRVQP RVHFFNYQSF MKKTPTVRWS KQETELFYEA IRQFGTDLSM  600
IQQLFPGRTR QQVKLKYKKE EREHPLRLTE ALTNRAKDHS HFEQVIEQLQ QFAAQAAQDA  660
KEDDSASMID EDLEELNPQY NRYICVFAG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1426448KKRAPRKSKETVSENGKTVRKRK
2442448KTVRKRK
3445449RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.118360.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423358.10.0uncharacterized protein LOC18035195 isoform X1
TrEMBLA0A067DY230.0A0A067DY23_CITSI; Uncharacterized protein
STRINGXP_006423357.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51542535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-52MYB_related family protein