PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005500m
Common NameCISIN_1g005514mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family TALE
Protein Properties Length: 694aa    MW: 76100.8 Da    PI: 7.3269
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005500mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.13.9e-103814181954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  orange1.1g005500m 381 FEHflHPYPKDSDKQMLAKQTGLTRSQVSNWFINARVR 418
                        554459******************************88 PP

2BELL122.61.6e-39245316172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        erqe+q+kkakL+++l+eV++rY+qy++q+q+vissFe++ag++sak Yt+lAlk+iS++FrcLkdai++qi
  orange1.1g005500m 245 ERQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVISSFEQAAGIESAKTYTALALKTISKQFRCLKDAITGQI 316
                        79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-63168314IPR006563POX domain
PfamPF075262.6E-49173313IPR006563POX domain
PROSITE profilePS5007112.39359422IPR001356Homeobox domain
SMARTSM003894.3E-10362426IPR001356Homeobox domain
CDDcd000861.39E-12362423No hitNo description
SuperFamilySSF466896.42E-17363428IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-29365428IPR009057Homeodomain-like
PfamPF059201.3E-18379418IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MATYFHGNPA EFQAPDGLQT LVLMNPTTYV QQQQQQHQQF SDTNHPPAPA PAHNSLIFLN  60
SSAISPHAPP PPSHTQHFVG IPTTAHQDDS ISPLHGLLPR VHYNLYNPNY PSPPARDTPR  120
AKQGLSLSLS SHQHPAFGSQ GGQTVSGEDI RVSGGSASSG SGVTNGVSGM QSVLLSSKYL  180
KAAQELLDEV VNVNNSGISN KSEFSKKGSG NNNSNINKVI GESSAAAGDD GQSAGKRAAE  240
LTTAERQEIQ MKKAKLINML DEVEQRYRQY HHQMQIVISS FEQAAGIESA KTYTALALKT  300
ISKQFRCLKD AITGQIKAAN KMLGEEDCVG SKIEGSRLKF VDHHLRQQRA LQQLGMIQHN  360
AWRPQRGLPE RSVSVLRAWL FEHFLHPYPK DSDKQMLAKQ TGLTRSQVSN WFINARVRLW  420
KPMVEEMYLE EIKDQEQNGS EDKTSKSEHN EDSASKSTAA QEKNLVKETQ NSKSFKSSED  480
NLTNQNVHSM ISMSTIATSP IGGGNARNHS GFSLIGSSEL EGLTQGSPKK PRNSDMNMML  540
SPSNVPSISI DVKPGGNEAT NDLMPMKFDD DDRQSRDGYS FIGNQMNFIQ GFGQYPIGEI  600
GRFDAEQFTP RFSGNGVSLT LGLPHCENLS LSATHQNFLP SQNIQLGRRV EIGEPNEFGT  660
INTQSPHASA AYENMNIQNR KRFAAQLLPD FVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16368426563Homeobox protein Meis2
3k2a_B2e-16368426563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.17170.0flower| fruit| leaf| stem| vegetative meristem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481600.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006481599.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A067FTF20.0A0A067FTF2_CITSI; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-171BEL1-like homeodomain 1