PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005124m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 714aa    MW: 77492.4 Da    PI: 9.2983
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005124mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.93.6e-3091175187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+ qe+laL+++r++m+ ++r++  k+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f+qlea
  orange1.1g005124m  91 RWPSQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YKFFTQLEA 175
                        8*********************************************************************866665..*******85 PP

2trihelix103.81.2e-32524609187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k evlaLi++r+ +e+r++++  k+plWee+s  m++ g++r++k+Ckekwen+nk++kk+ke++k+r +e+ +tcpyf++l+a
  orange1.1g005124m 524 RWPKVEVLALIKLRSGLEHRYQEAGPKGPLWEEISVGMQRMGYNRNAKRCKEKWENINKYFKKVKESNKRR-PEDAKTCPYFHELDA 609
                        8********************************************************************97.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.01288150IPR001005SANT/Myb domain
PROSITE profilePS500906.49390148IPR017877Myb-like domain
CDDcd122032.40E-2790155No hitNo description
PfamPF138379.0E-2190176No hitNo description
PROSITE profilePS500906.528517581IPR017877Myb-like domain
SMARTSM007170.022521583IPR001005SANT/Myb domain
PfamPF138374.4E-22523610No hitNo description
CDDcd122031.89E-29523588No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MQQGGGGGGD GEGGGGGGGT QSQYGEMATT STATAAAAAA HIDMGQQPVE AASPISSRPP  60
ASASNLDELM RLSGGDDDEG DRGGGVSSGN RWPSQETLAL LKIRSDMDAA FRDATVKGPL  120
WEDVSRKLAE LGYKRSAKKC KEKFENVHKY YKRTKEGRAG RQDGKSYKFF TQLEALHSSP  180
TSTSTSTATT SNVSASLPKP MTTVADTSTL DVAPVSVGIP MPISSSVRIP TSPITLTCFP  240
YHDLRSTLIP APSSAVNVPG SVTTPVPPTA TTSTTPVGIS FSSKSSSSSP ETEDDDDDVM  300
DFEGQPSNTA GTSNRGRNRK RKRQTSSSHR MMAFFEGLMK QVMQKQEAMQ QSFLEVIEKR  360
ERDRMIREEA WKRQEMSRLA REHELMAQER AISASRDASI INFLQKITGQ TIQLPPAITI  420
PAAPPPPPPQ PQSPSQAVPV ATNTTQSHHM PPPERRDIQQ HHHRHQQIQS SAAEAVTARH  480
QQPSGTVSTS IHSQVVMAVP EQQVPPSDHQ EIGSGGNLEP ASSRWPKVEV LALIKLRSGL  540
EHRYQEAGPK GPLWEEISVG MQRMGYNRNA KRCKEKWENI NKYFKKVKES NKRRPEDAKT  600
CPYFHELDAL YRKKIIGVGG TSTSSQNRPE ERHQSQSEQQ HQQENVNPVT NPQESSINVL  660
PAPLLITQAH SDSENKNGNA QASNVGVTGS LFGEGNLGAS KKVKILNSNF FSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141KRSAKKCKE
2315323GRNRKRKRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439158.10.0trihelix transcription factor GTL1 isoform X1
TrEMBLV4SWV00.0V4SWV0_9ROSI; Uncharacterized protein
STRINGXP_006439158.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-49Trihelix family protein