PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004973m
Common NameCISIN_1g004963mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 722aa    MW: 77798.7 Da    PI: 5.9275
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004973mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.2e-32302359260
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                        +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  +++++ei+Y+g Hnh+k
  orange1.1g004973m 302 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSL-EGHITEIIYKGAHNHPK 359
                        7****************************************.***************85 PP

2WRKY103.79.9e-33514572159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  orange1.1g004973m 514 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 572
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.848296360IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-28300360IPR003657WRKY domain
SuperFamilySSF1182902.62E-25301360IPR003657WRKY domain
SMARTSM007746.8E-36301359IPR003657WRKY domain
PfamPF031061.6E-24302358IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-37499574IPR003657WRKY domain
SuperFamilySSF1182901.57E-28506574IPR003657WRKY domain
PROSITE profilePS5081138.664509574IPR003657WRKY domain
SMARTSM007741.5E-37514573IPR003657WRKY domain
PfamPF031066.5E-25515572IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MVMAGIDDNM AVIGDWVPPS PSPRTFFAAI SGDDISSREP PSENGADGLS LGSQEQMTSG  60
NTEKKNMMTG GASTDLGPFS EQKSRLAARA GFNAPRLNTE SIRTSDLSLN PDIRSPYLTI  120
PPGLSPTTLL ESPVFLSNSL AQPSPTTGKF SFIPNGNGKS STCISEAPDK SKDNILEDIN  180
TSFAFKPVAE SGSFSLGTRN KQSFPSIEVS VQSENSPQNV NAAKVHSQYR NSLSLQVQTD  240
FSRATTEKDN GCNTILADQR VFDTFGGSTE HSPPLDEQQD EEGDQRGSGD SMVAGAGGAS  300
SEDGYNWRKY GQKQVKGSEY PRSYYKCTHP NCQVKKKVER SLEGHITEII YKGAHNHPKP  360
PPNRRSAIGS NPLDMQLDIH EQAGLQSGAD GDPSWANTQK GTAGGTPEWR HDTVEVTSAA  420
PVGPEYCNQS SALPAQNGTP YESGDAVDAS STFSNDEDED DQVTHCSVGF DGEEDESESK  480
RRKIEAYATE MSGATRAIRE PRVVVQTTSE VDILDDGYRW RKYGQKVVKG NPNPRSYYKC  540
TSAGCTVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS HVNSGSSSAV AAHAAAAGQI  600
HRPEPSQLHN SMARFDRPAS FGSFRVPGRQ QFGPSPGFSF GMHQPGLANL SMAGLGPGQP  660
ELPVLPVHPY LAQQRQVNEM GFMMPKGEPK VEPMSEPGLN LSNRSAVYQQ LMSRLPLGPQ  720
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36302575878Probable WRKY transcription factor 4
2lex_A1e-36302575878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024033318.10.0probable WRKY transcription factor 2 isoform X1
RefseqXP_024033319.10.0probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A067G2S20.0A0A067G2S2_CITSI; Uncharacterized protein
STRINGXP_006474751.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]