PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004251m
Common NameCISIN_1g004262mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 766aa    MW: 84238.8 Da    PI: 6.79
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004251mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-142468147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r rWT+eE+ ++++a k++G   W +I +++g ++ + q++s+ qk+
  orange1.1g004251m 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKKAVQIRSHAQKF 68
                       78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-151874IPR009057Homeodomain-like
PROSITE profilePS5129419.11973IPR017930Myb domain
TIGRFAMsTIGR015578.3E-162271IPR006447Myb domain, plants
SMARTSM007172.3E-112371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-72464IPR009057Homeodomain-like
PfamPF002499.6E-122467IPR001005SANT/Myb domain
CDDcd001672.06E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MDTYSSGEDL VLKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKKAVQ  60
IRSHAQKFFS KLEKEALSKG VPIGQAIDID IPPPRPKRKP RNPYPRKTCT NAPMSQIGAK  120
DGKLRSSVSS LRCNQVLDLE KEPICDRPNG DEKPTYTIES QKDNCSEVFI LHQEAHCSSV  180
SSVNKNSMPT PVGLRDSCNL REFVPSLKEV VNQDETRESY VTVELKANEK FGKPDAKLAL  240
QDNGSSKPLN LENACPSHEK SVHGEKRDDV ADALPTAEVQ ATQNYPRHVN VHILDGSLGT  300
GTQSPSDMPM QESIFHPIGE VHGNPNLFTN PAASATTENE SNVPKSTHQS FPTFHPPFTQ  360
FRHDQDDYRS FLHISSAFSS LIVSTLLQNP AAHAAASFAA TFWPYTNMET SADSPTCPQG  420
GFLSRQMSSP PSMAAIAAAT VAAATAWWAA HGLLPLCAPF HAPFICPPAC ATAVSSMDTA  480
QVPAAKTDKN DNTPPNPALK DHQPDLEYSE ALQAQNSASK SLTVLTSDSE ESASAKLKME  540
LKATDHEKNS EENELHDSNK TKNRKQVDRS SCGSNTPSSS EVETDALEKQ EKGKEESKEI  600
DPSLPATDPG NRRSRSSSNI TDSWKEVSEV GRLAFQALFS REVLPQSFSP PHDLKDKMQQ  660
DNVEDKQNGN KKDGDKSLFD LNSKTWGSCF GHQEVEKSTV SGVENNGGEG LLTIGLGHGK  720
LKARRTGFKP YKRCSVEAKE NRILNTGNQA EEKCPKRIRV EGATT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194100RPKRKPR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.37600.0flower| fruit| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006491389.10.0protein LHY-like isoform X1
RefseqXP_006491390.10.0protein LHY-like isoform X1
RefseqXP_006491391.10.0protein LHY-like isoform X1
RefseqXP_006491392.10.0protein LHY-like isoform X1
TrEMBLA0A067H3R20.0A0A067H3R2_CITSI; Uncharacterized protein
STRINGXP_006491389.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-129MYB_related family protein