PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g003968m
Common NameCISIN_1g003968mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 784aa    MW: 85847.2 Da    PI: 5.8189
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g003968mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.83.3e-16487525240
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        ++k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  orange1.1g003968m 487 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 525
                        689**********************************96 PP

2TCR50.73.5e-16572611140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  orange1.1g003968m 572 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNTF 611
                        589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-18486527IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.621487612IPR005172CRC domain
PfamPF036381.1E-11489524IPR005172CRC domain
SMARTSM011148.7E-18572613IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11574610IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MDTPKKATQM ATPLSKFEDS PVFNYINSLS PIKPVKSLPV TQTFNSLNFS SPPSIFTSPH  60
ISAHKETRFL RRNNCLGLSK PEFSSENGNK ICRNDGVAND ASQLYDNSAE LQENFDPRVS  120
MEEVSVEASN DSKFAIELPQ ALKYDCGSPG CDSNPCNIES NCMTEMASTS VSVVQFVQEA  180
SENGASEADV RLQRTCQMEQ KNEVTGCEWE SLISDAADLL IFNLPNDSED FKGLMQKSLD  240
SGGRYASVTP RYINGQPIME MIDPVGTDHQ NGMEHQSTQP GETSILNDEL DECFTGDPSE  300
NGVTAMGMSN PASCKPISNL HRGMLRRCLD FELVTRRKNA DGSSNYGSSV ILHSDEKFAS  360
EDKQLVPLKP GSDSPRCMVP GIGLHLNALA ITPQENKNIG IESLSSVRQI SLPGANASFH  420
SPENCEDPHH EPLTSASTER DIVAVENGVL LAEDASQTSA YLAEEEYNQN SPKKKRRRME  480
NAGENESCKR CNCKKSKCLK LYCECFAAGV YCIEPCSCQD CFNKPIHEDT VLATRKQIES  540
RNPLAFAPKV IRSSDSLPEV GEDTSKTPAS ARHKRGCNCK KSSCLKKYCE CYQGGVGCSI  600
NCRCEGCKNT FGRKDGSSST DPEAEPEDEE MEMCEKSGVD KRFQKTEFLS NEEQNPGSAL  660
PTTPLRLSRP LVQLPFSTKC KPPRSLLSIG SSSGFFTGHN YGKPNILRSQ PKFEKSLQTA  720
PEDEMPEILR GNCTPCSGIK TSSPNSKRVS PPHTILGSSP SRRSGRKLIL QSIPSFPSLT  780
PKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1749160914120Protein lin-54 homolog
5fd3_B5e-1749160914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1472477KKKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006489438.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A067G7A00.0A0A067G7A0_CITSI; Uncharacterized protein
STRINGXP_006489438.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-148TESMIN/TSO1-like CXC 2