PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g003908m
Common NameCISIN_1g0038981mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 788aa    MW: 87372.9 Da    PI: 6.3922
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g003908mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.2e-085395347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +WT eE+e +  a +q G++ +++I +++   +   q++++++ +
  orange1.1g003908m 53 AWTREEEESFFTALRQVGKN-FEKITHRVR-SKNKDQVRHYYYRL 95
                       6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1046100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-54798IPR009057Homeodomain-like
PROSITE profilePS5129313.02149100IPR017884SANT domain
SMARTSM007179.8E-75098IPR001005SANT/Myb domain
PfamPF002493.4E-65395IPR001005SANT/Myb domain
CDDcd001676.70E-75396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MQMESQLSMN SEVHLHPRNT PVQDEDPRVV ASSTLDNVIL QQSAKRPTRQ WAAWTREEEE  60
SFFTALRQVG KNFEKITHRV RSKNKDQVRH YYYRLVRRMN KLLGPGLCLD AKNSKDTNAA  120
MLRWWSLLEK YSCKASKLHL KPRRFKIFVE ALEHQLLKDR KRSVRKRPSQ RDNYSPTVPT  180
PIPNQSRTSG QDTCTVKLVL VDSQNIQKLG PAKGSLKRNV NIGINRSNNK ADSATLKPRQ  240
RRKPDSISSA AYKKWEKAAI AGVSLVADAA EHLERTSTDK EVERQQEHTA LETADKVLPP  300
LPTISPTLFA EGNVQTPVKL KLQLYPIDDG TRKALEMDNH NPHLELTLST RKKISSVLEH  360
LNRKWGNASV ASGELMLFPY GAQRENLVGY QRWTQDSVFS AADVYAMIGS PPMFRLRYGW  420
FSDTELGYVA PHAPSASGCV PSFHNINVEN KKEQIVDSVP GRVPSTSDQS ENFVDPYKKL  480
TSVKENDTFA TSSSSMPKET SSYISASKRD IADTSDPAAN VSWPRKETGN EIITGQVEDM  540
GDERLSSGTA LSAGEWADSL TNISVGDLLA EVPHDLDAAP VAESSQCLQQ IPFSCDSFDA  600
AIAAHISRHQ NKMGALSTLA SHASSIWDAE ETCDAFSFQK NPVLCNEVSR LPDIAPPAAD  660
CEQIARTNSE LLDAEGPTDY PAHEDPMDDC LRNPHTLDNS VNDFNGLTDI YWPDSLGPLD  720
LDIPSSKYRG EDIILSDSLG GLNRLIASSL DAFQNCSFFG LDKKEPTPTV EAGETASFSD  780
FKIGSQG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.33130.0seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428404.10.0TSL-kinase interacting protein 1 isoform X4
RefseqXP_015380958.10.0TSL-kinase interacting protein 1 isoform X4
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A067E2N40.0A0A067E2N4_CITSI; Uncharacterized protein
STRINGXP_006428399.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1