PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g003898m
Common NameCISIN_1g0038981mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 789aa    MW: 87443.9 Da    PI: 6.3922
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g003898mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.2e-085395347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +WT eE+e +  a +q G++ +++I +++   +   q++++++ +
  orange1.1g003898m 53 AWTREEEESFFTALRQVGKN-FEKITHRVR-SKNKDQVRHYYYRL 95
                       6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1046100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-54798IPR009057Homeodomain-like
PROSITE profilePS5129313.02149100IPR017884SANT domain
SMARTSM007179.8E-75098IPR001005SANT/Myb domain
PfamPF002493.4E-65395IPR001005SANT/Myb domain
CDDcd001676.71E-75396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MQMESQLSMN SEVHLHPRNT PVQDEDPRVV ASSTLDNVIL QQSAKRPTRQ WAAWTREEEE  60
SFFTALRQVG KNFEKITHRV RSKNKDQVRH YYYRLVRRMN KLLGPGLCLD AKNSKDTNAA  120
MLRWWSLLEK YSCKASKLHL KPRRFKIFVE ALEHQLLKDR KRSVRKRPSQ RDNYSPTVPT  180
PIPNQSRTSG QDTCTVKLVL VDSQNIQKLG PAKGSLKRNV NIGINRSNNK ADSATLKPRQ  240
RRKPADSISS AAYKKWEKAA IAGVSLVADA AEHLERTSTD KEVERQQEHT ALETADKVLP  300
PLPTISPTLF AEGNVQTPVK LKLQLYPIDD GTRKALEMDN HNPHLELTLS TRKKISSVLE  360
HLNRKWGNAS VASGELMLFP YGAQRENLVG YQRWTQDSVF SAADVYAMIG SPPMFRLRYG  420
WFSDTELGYV APHAPSASGC VPSFHNINVE NKKEQIVDSV PGRVPSTSDQ SENFVDPYKK  480
LTSVKENDTF ATSSSSMPKE TSSYISASKR DIADTSDPAA NVSWPRKETG NEIITGQVED  540
MGDERLSSGT ALSAGEWADS LTNISVGDLL AEVPHDLDAA PVAESSQCLQ QIPFSCDSFD  600
AAIAAHISRH QNKMGALSTL ASHASSIWDA EETCDAFSFQ KNPVLCNEVS RLPDIAPPAA  660
DCEQIARTNS ELLDAEGPTD YPAHEDPMDD CLRNPHTLDN SVNDFNGLTD IYWPDSLGPL  720
DLDIPSSKYR GEDIILSDSL GGLNRLIASS LDAFQNCSFF GLDKKEPTPT VEAGETASFS  780
DFKIGSQG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.33130.0seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493025.10.0TSL-kinase interacting protein 1 isoform X5
RefseqXP_024038219.10.0TSL-kinase interacting protein 1 isoform X5
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A067E6310.0A0A067E631_CITSI; Uncharacterized protein
STRINGXP_006493020.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96332124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1