PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g002317m
Common NameCISIN_1g002317mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Nin-like
Protein Properties Length: 937aa    MW: 104477 Da    PI: 6.4253
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g002317mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.61.4e-29619668352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        k+i+l++l++yFs+++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  orange1.1g002317m 619 KTITLQVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 668
                        89**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.461607688IPR003035RWP-RK domain
PfamPF020423.1E-26620668IPR003035RWP-RK domain
SuperFamilySSF542777.85E-24839923No hitNo description
PROSITE profilePS5174528.175839922IPR000270PB1 domain
SMARTSM006669.1E-28839922IPR000270PB1 domain
PfamPF005643.6E-21840921IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.7E-24841919No hitNo description
CDDcd064073.00E-41841920No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MEDTVFLPGT MRGASLDSAM DLDYMNELLA EGCWLETIDG SEFPHPSPST STALFDSSFV  60
WPASEITNGD TGRNPSQQGK QDDMQQSFFL QTSSMNDPQQ NGPLSTPSLS QGMVNVDEDD  120
GQLDDNIAEG SELSKRRWIG PRANLGPATS VIQRLGWAVG YIKDFSINKD VLIQLWVPVI  180
RAGRQVLTTY DQPFSLDLKC QRLANYRAIS IKYYFSAEED SKDVAGLPGR VFLGKAPEWT  240
PDVQFFRSDE YPRVDHAQQY DVRGTLAVPV FEQGSRTCLG VIEVVMMTQK LKYRSELESV  300
CKALEAVDLR SSEVPSTKNM KAWNTSYQAA LPEIREVLRC ACETHRLPLA QTWVSCIQQG  360
KVGCWHSDKN NNHCVSTVDD ACYIADPDMW GFQEACSEHH LLKGQRVAGE AFLTNQPCFS  420
NDITSLKKTE YPLSHHARMF GLCGAVAIRL RSILTGNSDF VLEFFLPKGC RDPEEQKKML  480
SSLSIVIQQV SRSLRVVTDK EMEEETSLPV SEVIFPSDGR PSREKILKVD SHSEKYSHDN  540
SFQSACLTKV QRDCDVSLNQ NGKPRKVSGK RFLEGGHRKE DFSLKGSAEY CDDSNSVEGS  600
FSSVALGKTG EKRRTKVDKT ITLQVLQQYF SGSLKDAAKS IGVCPTTLKR ICRQHGIKRW  660
PSRKIKKVGH SLQKLQLVID SVQGASGSFQ IGSFYTNFPE LASPNLSRSG ASPFSNSLPT  720
DQQKLTGMQA KGGTLSPQAQ AAKSPSSSCS QSSNSSQCCT SGTQQHRSTN NIAGSEDPVV  780
GESFDDVVLK RVRSYEELHA SSQEPRLLPR SQSYKSFREQ PIPRLPENGC RMSQEVVDGR  840
RVKVTYGEEK IRLRMQDNWK FQDLLQEIAR RFNIDDMSLF DVKYLDDDSD WVLLTCDADL  900
EECIEVCRSS EGQTIKLLLQ VSHHLFERRS GSSGNS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.173830.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0562690.0KX056269.1 Citrus trifoliata transcription factor NLP4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435364.10.0protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A067GZS40.0A0A067GZS4_CITSI; Uncharacterized protein
TrEMBLV4TAM90.0V4TAM9_9ROSI; Uncharacterized protein
STRINGXP_006435364.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein