PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395430.3
Common NameCsa_2G354030, LOC101202772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 489aa    MW: 52191.6 Da    PI: 8.9634
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395430.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.51.3e-2481125145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Cucsa.395430.3  81 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 125
                     79****************************************985 PP

2QLQ60.16.3e-211247237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++Q+++L++Q+l+yKy+ an+PvP++Ll +i+k
  Cucsa.395430.3 12 PFTPSQWMELEQQALIYKYITANVPVPSYLLIPIRK 47
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.3E-121147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.7021247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.9E-151246IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.66381125IPR014977WRC domain
PfamPF088795.5E-2182124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MHGSSFIGVR APFTPSQWME LEQQALIYKY ITANVPVPSY LLIPIRKAFE SAGFSAFSGG  60
FLRPGTVGWG SFNMGFSNSS DPEPGRCRRT DGKKWRCSRD AVADQKYCER HMNRGRHRSR  120
KPVEGQAGHS HSVAGASNIT TATAATKLIS SSASTAAVPC NGSPNSLSFA NQHFKNLQRP  180
GSHPPPSSAA AQINRMLITN KENGGIGLLD STTTSGLSVL SPSIDIKHSK QLPFAIQKQQ  240
NPFEESPRGT EFGLVPSDFL LGSSQKSSSL MNYRGFNPSE GIASTQESAE SHHSLRQFFN  300
NWPKNQPDSS SVSWSNSNLD PQSDRTQLSI SIPMATSDFR SSTSSPANDK LTLSPLKSAQ  360
ELDPIQMGLG VGNVMDEPNN RQANWIPISW ESSMGGPLGE VLNSTNNNGG ESKSSSMLNL  420
MTEGWDNSPS LGSSPTGVLQ KTAFGSFSNS STGSSPRTEN HKTNEGGGGG SSQCSDRFVN  480
SSSSLPSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143032.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLA0A0A0LR180.0A0A0A0LR18_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-92growth-regulating factor 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]