PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395430.2
Common NameCsa_2G354030, LOC101202772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 671aa    MW: 71051 Da    PI: 7.5003
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395430.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24263307145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Cucsa.395430.2 263 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 307
                     79****************************************985 PP

2QLQ59.59.4e-21196231237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FT++Q+++L++Q+l+yKy+ an+PvP++Ll +i+k
  Cucsa.395430.2 196 PFTPSQWMELEQQALIYKYITANVPVPSYLLIPIRK 231
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.3E-12195231IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-14196230IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.702196231IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663263307IPR014977WRC domain
PfamPF088798.2E-21264306IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MDFGVVGLDG GVVVVGSSDT SGFSSLAAAA ASSDAETTKQ KWYESVSGFI HKQERSASVA  60
APQEQDDDDG VGGGGGGGGD EDLRTSKLLK TSDHLSSSTS SSTKGFLFPH RHSASLLRST  120
NSSPFFLSDS NQNHHHQMLC FSSPKTESFP LDKTSSLSAV SPNLYHSSAP RNAGCNYGGL  180
NGGSMHGSSF IGVRAPFTPS QWMELEQQAL IYKYITANVP VPSYLLIPIR KAFESAGFSA  240
FSGGFLRPVG WGSFNMGFSN SSDPEPGRCR RTDGKKWRCS RDAVADQKYC ERHMNRGRHR  300
SRKPVEGQAG HSHSVAGASN ITTATAATKL ISSSASTAAV PCNGSPNSLS FANQHFKNLQ  360
RPGSHPPPSS AAAQINRMLI TNKENGGIGL LDSTTTSGLS VLSPSIDIKH SKQLPFAIQK  420
QQNPFEESPR GTEFGLVPSD FLLGSSQKSS SLMNYRGFNP SEGIASTQES AESHHSLRQF  480
FNNWPKNQPD SSSVSWSNSN LDPQSDRTQL SISIPMATSD FRSSTSSPAN DKLTLSPLKS  540
AQELDPIQMG LGVGNVMDEP NNRQANWIPI SWESSMGGPL GEVLNSTNNN GGESKSSSML  600
NLMTEGWDNS PSLGSSPTGV LQKTAFGSFS NSSTGSSPRT ENHKTNEGGG GGSSQCSDRF  660
VNSSSSLPSV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649553.10.0PREDICTED: growth-regulating factor 1-like isoform X2
TrEMBLA0A0A0LR180.0A0A0A0LR18_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-93growth-regulating factor 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]