PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395430.1
Common NameCsa_2G354030, LOC101202772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 673aa    MW: 71209.2 Da    PI: 7.5003
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395430.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24265309145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Cucsa.395430.1 265 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 309
                     79****************************************985 PP

2QLQ59.59.4e-21196231237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FT++Q+++L++Q+l+yKy+ an+PvP++Ll +i+k
  Cucsa.395430.1 196 PFTPSQWMELEQQALIYKYITANVPVPSYLLIPIRK 231
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.3E-12195231IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-14196230IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.702196231IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663265309IPR014977WRC domain
PfamPF088798.2E-21266308IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MDFGVVGLDG GVVVVGSSDT SGFSSLAAAA ASSDAETTKQ KWYESVSGFI HKQERSASVA  60
APQEQDDDDG VGGGGGGGGD EDLRTSKLLK TSDHLSSSTS SSTKGFLFPH RHSASLLRST  120
NSSPFFLSDS NQNHHHQMLC FSSPKTESFP LDKTSSLSAV SPNLYHSSAP RNAGCNYGGL  180
NGGSMHGSSF IGVRAPFTPS QWMELEQQAL IYKYITANVP VPSYLLIPIR KAFESAGFSA  240
FSGGFLRPGT VGWGSFNMGF SNSSDPEPGR CRRTDGKKWR CSRDAVADQK YCERHMNRGR  300
HRSRKPVEGQ AGHSHSVAGA SNITTATAAT KLISSSASTA AVPCNGSPNS LSFANQHFKN  360
LQRPGSHPPP SSAAAQINRM LITNKENGGI GLLDSTTTSG LSVLSPSIDI KHSKQLPFAI  420
QKQQNPFEES PRGTEFGLVP SDFLLGSSQK SSSLMNYRGF NPSEGIASTQ ESAESHHSLR  480
QFFNNWPKNQ PDSSSVSWSN SNLDPQSDRT QLSISIPMAT SDFRSSTSSP ANDKLTLSPL  540
KSAQELDPIQ MGLGVGNVMD EPNNRQANWI PISWESSMGG PLGEVLNSTN NNGGESKSSS  600
MLNLMTEGWD NSPSLGSSPT GVLQKTAFGS FSNSSTGSSP RTENHKTNEG GGGGSSQCSD  660
RFVNSSSSLP SV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143032.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLA0A0A0LR180.0A0A0A0LR18_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.16e-95growth-regulating factor 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]