PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.378420.1
Common NameCsa_3G751470, LOC101203628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 417aa    MW: 45258.9 Da    PI: 8.5783
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.378420.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.85.9e-26150194145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e+
  Cucsa.378420.1 150 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVET 194
                     79****************************************986 PP

2QLQ45.22.8e-1677112237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +F+aaQ q+L+ Q+l+++y++a++ vPpeLl  i+k
  Cucsa.378420.1  77 YFSAAQRQELELQALIFRYMIAGAAVPPELLHLIKK 112
                     7******************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.6E-776112IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.66277112IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-1177110IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.192150194IPR014977WRC domain
PfamPF088792.5E-22151193IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDFDLKQCRK QRESESDEHQ NSSKISKFFP QQNPLNPSSS SSSSSSPVLP LFVPSKTSNT  60
LSAFSDSSST LPRMLGYFSA AQRQELELQA LIFRYMIAGA AVPPELLHLI KKSLLSSTTA  120
PLFLHHPLQH FPHYPTSLLQ AGYWGKAAMD PEPGRCRRTD GKKWRCSRDV VAGQKYCERH  180
MHRGRNRSRK PVETATNNAA TTAGGSGSGG GCSISSNSNR GGGGGRPFLT VESGNYFSMC  240
EQTPSVDLLH LNQGSCSNSL SENKNFYQSH KEPSTGDVKP DGHILRHFFD DWPRSENDGC  300
GNDNTNNVNQ RMNSTSASAT SLSISMPSLT SDVSLKLSTG GSSDRGSDHH NHQNGNVDRE  360
QHTHLNWAAG WAATQMASMG GPLAEALRSA NNSSLPTSVL HQLQRTTNSE ASFIST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138010.20.0PREDICTED: growth-regulating factor 3-like
TrEMBLA0A0A0LEG10.0A0A0A0LEG1_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g03760.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.18e-56growth-regulating factor 4
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]