PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.349800.1
Common NameCsa_6G095910, LOC101214878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 745aa    MW: 81754.5 Da    PI: 5.7913
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.349800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   Cucsa.349800.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.1E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.1E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-82464IPR009057Homeodomain-like
CDDcd001671.43E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDPNSSGEDL VFKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALVKG IPVGQTLDID IPPPRPKRKP SNPYPRKTPI SKLGANDGKV  120
LTLVSSSQRK QILDLEKEPL NEGTSGEEQA TIEKDAHDDN YSEVFTLSRE ANSISWKNTN  180
CVPSQVKLND SCAFREFVPS LKEPLQDKGP GKVLEMEISS TSQEKSMPAE KKEALSCVLS  240
GDEMQAAHNY PRHVPVHVVD GSLGANVQGS VTDTLLQEST FHPAMEVRGE HNIIGNPSDC  300
VSFEHQNNAP RCVYQSYPTI HPTPFTLLRP NQEHYKSLLH MSSSFSNLVV STLQQNPAAH  360
AIASLTATCW PYVNPETSVD SPVCDKEGSG TKQMNPTPSM EAIAAATVAA ATAWWAAHGL  420
LPLCAPFHSA FPSAGVSAPV VQSSDTCQNL ESKDKAESSQ QIVALQNQQL DAEQSEALTA  480
QHSGSKLPTH SSSDSEGSGG ANANDTVKPA HDEKTPAEVE FHDSNKGKRG KQVDRSSCGS  540
NTPSGSDQEI DATENNDKEE KEEENDLEMN RPAVELSNRR NRSISNTSES WKEVSDELTF  600
SRNVYTIQGR LAFQALFTRD VLPQSFSPPY DVENENKASE NVEKDSHVVD KDSGASVLDL  660
NGKTCGSFSH QSMERDTSAI GINNGEGELL TIGLGNGTPK ACRTGFKPYK RCSVEAKEKR  720
MTTSSNHCEE GGQKRLRLEQ KVTN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656823.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011656824.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011656825.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011656826.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011656827.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011656828.10.0PREDICTED: protein LHY-like isoform X1
TrEMBLA0A0A0K9R40.0A0A0A0K9R4_CUCSA; Uncharacterized protein
STRINGXP_004140527.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-103MYB_related family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]