PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.309470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family VOZ
Protein Properties Length: 466aa    MW: 52201.1 Da    PI: 5.8587
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.309470.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ431.51.2e-1322294451217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     p+psaf+gp calwdc+rpaqgs+w+qdycss+h++la+neglpg+ p+lrp+gi++kdg+lfaal+ak+q+kevgip c+gaat+kspwna+el
  Cucsa.309470.1 229 PRPSAFMGPICALWDCFRPAQGSKWCQDYCSSCHSVLAINEGLPGMIPILRPGGIGFKDGPLFAALQAKTQAKEVGIPICDGAATRKSPWNAPEL 323
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fd+++legetirewl+fdkprrafesgnrkqrslpdysgrgwhesrk vmkefgg+k+syymdpqpss++ewhlyey+i+++d++alyrlelk++
  Cucsa.309470.1 324 FDITFLEGETIREWLYFDKPRRAFESGNRKQRSLPDYSGRGWHESRKLVMKEFGGQKKSYYMDPQPSSTLEWHLYEYDITNYDSFALYRLELKHA 418
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrlta 217
                     d+kks+kgk+++d+ladlqkk+grlta
  Cucsa.309470.1 419 DTKKSPKGKLAADPLADLQKKMGRLTA 445
                     *************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MPKGLKSKCQ STSHQLLKEK AKNRVNDLQG IFTNLQNARK ESRTTDVAVL EEQVHQMLRE  60
WNAELNEPSP ASSLVEGSLG SFSQELARLL EHCDEQDDAT STLAEPKAEP ELHCILGSNP  120
SNFVQDGFCI PELQHESFFG FEECKVSPLD IQNYSFYKSD MATQSNCQSF KLDQNLEQTT  180
MVSKDDMSTL NCHILNSQPE FDYGVLIGAS DVGDFIQDTK PSILPNIAPR PSAFMGPICA  240
LWDCFRPAQG SKWCQDYCSS CHSVLAINEG LPGMIPILRP GGIGFKDGPL FAALQAKTQA  300
KEVGIPICDG AATRKSPWNA PELFDITFLE GETIREWLYF DKPRRAFESG NRKQRSLPDY  360
SGRGWHESRK LVMKEFGGQK KSYYMDPQPS STLEWHLYEY DITNYDSFAL YRLELKHADT  420
KKSPKGKLAA DPLADLQKKM GRLTAEGPVE LGQQVKGKMT MKRNN*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819160.0LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649982.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_011649983.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-167VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S3C2S30.0A0A1S3C2S3_CUCME; transcription factor VOZ1-like
STRINGXP_004158584.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-170vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]