PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.302660.1
Common NameCsa_5G156150, LOC101206054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 302aa    MW: 33841.1 Da    PI: 6.6306
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.302660.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.9e-082502832154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  Cucsa.302660.1 250 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 283
                     469*****************************87 PP

2ELK25.53.2e-09204225122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  Cucsa.302660.1 204 ELKIELKQGFKSRIEDVREEIL 225
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.5E-193377IPR005540KNOX1
PfamPF037906.5E-183576IPR005540KNOX1
SMARTSM012561.9E-2493148IPR005541KNOX2
PfamPF037911.6E-1797147IPR005541KNOX2
PROSITE profilePS512139.132204224IPR005539ELK domain
PROSITE profilePS5007111.677224287IPR001356Homeobox domain
SuperFamilySSF466894.06E-16226291IPR009057Homeodomain-like
SMARTSM003891.4E-10226291IPR001356Homeobox domain
CDDcd000861.18E-11227288No hitNo description
Gene3DG3DSA:1.10.10.607.1E-25231289IPR009057Homeodomain-like
PfamPF059201.0E-17244283IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MQEPGLGMMT AAGGSSGGLS GDVSVSGEGV HNSQLKAEIA THPLYEQLLS AHVACLRVAT  60
PIDQLPMIDA QLSQSHHILR SYASSQQHHQ NAHSLTPHER QELDNFLAQY MIVLCSFKEQ  120
LQQHVRVHAV EAVMACREIE NTLQALTGVS LGEGTGATMS DDEDDIPMDF SLDQSGADAH  180
DMMGFGPLLP TESERSLMER VRQELKIELK QGFKSRIEDV REEILRKRRA GKLPGDTTTV  240
LKNWWQQHSK WPYPTEDDKA KLVEETGLQL KQINNWFINQ RKRNWHSNSQ SVTSLKSKRK  300
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12227283864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280300RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818951e-164LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132631e-164LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143939.10.0PREDICTED: homeobox protein knotted-1-like 7
SwissprotQ9FPQ81e-175KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0A0KKD30.0A0A0A0KKD3_CUCSA; Uncharacterized protein
STRINGXP_004143939.10.0(Cucumis sativus)
STRINGXP_004159970.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-172KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  5. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  6. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  7. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]