PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.285250.1
Common NameCsa_5G604920, LOC101221595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 299aa    MW: 34023.8 Da    PI: 6.7999
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.285250.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.9e-1886139356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Cucsa.285250.1  86 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 139
                     456899***********************************************9 PP

2HD-ZIP_I/II130.28.4e-4285177193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+++a+k++ne+L++++++L++e+++
  Cucsa.285250.1  85 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFEAIKSDNEALKSHNQKLQAEIMA 177
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1975143IPR009057Homeodomain-like
PROSITE profilePS5007117.32981141IPR001356Homeobox domain
SMARTSM003891.8E-1784145IPR001356Homeobox domain
PfamPF000463.0E-1586139IPR001356Homeobox domain
CDDcd000861.40E-1586142No hitNo description
Gene3DG3DSA:1.10.10.605.1E-1988148IPR009057Homeodomain-like
PRINTSPR000311.2E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5121137IPR000047Helix-turn-helix motif
PfamPF021831.8E-16141181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTSNGMAFFP ANFMLQPSHE DHDHHHHSNS PPSLNPILPS CTPQDFHGVA SFLGKRSMSF  60
SGTEMVEEGN NGEDEFSDDG SQAGEKKRRL NMEQVKTLEK NFELGNKLEP ERKMQLARAL  120
GLQPRQIAIW FQNRRARWKT KQLEKDYDLL KRQFEAIKSD NEALKSHNQK LQAEIMALKS  180
REPTESINLN KETEGSCSNR SENSSDNIKL DISRTPAIDS PHQQHPTNRP LFPTSSSLRP  240
PALAQLFQTS SRSSDHPPKQ IDNHHQIPKE ESSSLSNMFC GMDDHSGFWP WLEQQHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135187.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-127ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0A0KQK40.0A0A0A0KQK4_CUCSA; Uncharacterized protein
STRINGXP_004135187.10.0(Cucumis sativus)
STRINGXP_004155316.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-117HD-ZIP family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  6. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  7. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]