PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.281950.1
Common NameCsa_1G433050, LOC101203427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 265aa    MW: 30632.2 Da    PI: 7.2519
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.281950.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.6e-18136190256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq + Lee F+ + +++ ++++ LA++l+L++rqV vWFqNrRa+ k
  Cucsa.281950.1 136 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTK 190
                     788899***********************************************98 PP

2HD-ZIP_I/II118.24.5e-38136224190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rlskeq++lLEesF+ +++L+p +K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +
  Cucsa.281950.1 136 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTKLKQTEVDCEFLKKCCERLNEENRRLKKELNELR-S 224
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-18119193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-16125190IPR009057Homeodomain-like
PROSITE profilePS5007117.2132192IPR001356Homeobox domain
SMARTSM003893.8E-15134196IPR001356Homeobox domain
CDDcd000867.66E-15136193No hitNo description
PfamPF000461.7E-15136190IPR001356Homeobox domain
PROSITE patternPS000270167190IPR017970Homeobox, conserved site
SMARTSM003408.6E-19192235IPR003106Leucine zipper, homeobox-associated
PfamPF021838.3E-9192225IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEDHHEDEIC NISWLSLGLG FGDQYVPKKI QKNQQQQQQL SFTLIPKEEL EITNNNNMEI  60
DDDEANSSEE DDDHHLMKRI RSSNNIVNYD HHRQDSSFGS IRRLSSDHYI NNSDIVNTTN  120
HNYKGISSSG SELRERKKLR LSKEQSTLLE ESFKLHTTLN PAQKQALAQQ LNLKTRQVEV  180
WFQNRRARTK LKQTEVDCEF LKKCCERLNE ENRRLKKELN ELRSLKLGAS QLYIQLPKAA  240
TLTICPSCDK ITRTPAVDAN SPPQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139RERKKLR
2184192RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150745.10.0PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotQ054663e-54HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A0A0M0120.0A0A0A0M012_CUCSA; Uncharacterized protein
STRINGXP_004150745.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-45homeobox protein 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  7. Müller-Moulé P, et al.
    YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance.
    PeerJ, 2016. 4: p. e2574
    [PMID:27761349]
  8. Ivarson E, et al.
    Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre.
    Front Plant Sci, 2016. 7: p. 2032
    [PMID:28119714]
  9. Kasulin L, et al.
    A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina.
    Mol. Ecol., 2017. 26(13): p. 3389-3404
    [PMID:28316114]
  10. Singh M,Gupta A,Singh D,Khurana JP,Laxmi A
    Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth.
    Sci Rep, 2017. 7(1): p. 16101
    [PMID:29170398]