PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.259800.1
Common NameCsa_3G117960, LOC105434392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 274aa    MW: 30747.4 Da    PI: 8.0844
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.259800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.8e-4136113178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++ l +ak+yhrrh+vCe+hskap+v+v gl qrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Cucsa.259800.1  36 RCQVEGCHVALVNAKDYHRRHRVCEMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSCRRRLAGHNERRRKSSH 113
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-343398IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.45334111IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3835115IPR004333Transcription factor, SBP-box
PfamPF031105.1E-3237110IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MCLNLGKRHY FEDSNAPSLI LGKRAKPPFY ATTVPRCQVE GCHVALVNAK DYHRRHRVCE  60
MHSKAPKVVV LGLDQRFCQQ CSRFHVISEF DDSKRSCRRR LAGHNERRRK SSHESARNCT  120
QAENKSMTNG IAYVPSPTGR ALSLLSSKNE SWANSSELSQ RSSAALRELI AENRAAILAR  180
QLILDRDWHP NHGGTDDFGG GGGVGFQQQG LYCEQQHSWE RMNENGGSHV TLDLMQAPSS  240
AFGLLSVREK SKEEDEECCE LWNSFNDHDP HVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-30371101184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004133774.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ7XT421e-55SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0A0L8C00.0A0A0A0L8C0_CUCSA; Uncharacterized protein
STRINGXP_004155257.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-40squamosa promoter binding protein-like 10
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]