PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.258660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 310aa    MW: 34694.4 Da    PI: 9.8629
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.258660.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-1356100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   Cucsa.258660.1  56 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 100
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-1750106IPR009057Homeodomain-like
PROSITE profilePS5129415.21151105IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-654106IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1854103IPR006447Myb domain, plants
SMARTSM007175.3E-1155103IPR001005SANT/Myb domain
PfamPF002492.5E-1156100IPR001005SANT/Myb domain
CDDcd001671.76E-858101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MNMSHFPGID SVRTPTPPPL RTAALPTSTS NSVAAFPVSE DASKKIRKPY TITKSRESWT  60
EQEHDKFLEA LQLFDRDWKK IEAFVGSKTV IQIRSHAQKY FLKIQKSGKS EHVPPPRPKK  120
KASHPYPQKA PKNATTQHPG MYQPLSSPLE PRYIYIPDST AGFGLPSPNA TFSSWSCSPM  180
PTIDVSQVPK VGGSTLAHSS SSESTPRTWK LGEISDQGNQ SMRNRVMPDF AQVYRFIGSV  240
FDPTVSGHIQ RLRKMDPINL ETTLLLMQNL AINLISPEFE NHFQACYGLY TSTVFHQHLT  300
SYYPPPHPD*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818483e-95LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132603e-95LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650733.10.0PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W37e-99RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0A0L4360.0A0A0A0L436_CUCSA; Uncharacterized protein
STRINGXP_008437994.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-101MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]