PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.257800.2
Common NameCsa_3G124990, LOC101211224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 464aa    MW: 50661.6 Da    PI: 10.0845
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.257800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.55.4e-24115159145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++ +k+CErH+hrgr+rsrk++e+
  Cucsa.257800.2 115 DPEPGRCRRTDGKKWRCSRNTVPHQKYCERHMHRGRQRSRKPVEA 159
                     79****************************************997 PP

2WRC63.63e-20352391241
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                      epgrCrRtDGKkWRC+r+v++++k+C  H+hrg+++  k
  Cucsa.257800.2 352 LEPGRCRRTDGKKWRCRRDVIPDQKYCALHMHRGSKKHLK 391
                     59********************************887655 PP

3QLQ47.65.2e-175288137
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    s +Ta Qlq+L++Q+l+ KyLaa++ vP +Ll++i+k
  Cucsa.257800.2 52 SILTAGQLQELEQQVLIHKYLAAGVRVPTHLLVPIWK 88
                    579********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.7E-85288IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.4985388IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-105487IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.432115159IPR014977WRC domain
PfamPF088792.1E-20116158IPR014977WRC domain
PROSITE profilePS5166720.514351395IPR014977WRC domain
PfamPF088798.1E-18353391IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MMMEVKKEVN QSENDEVSTP VLPSINLGLQ IGTNSAGSRN ERNSIVRRSR ESILTAGQLQ  60
ELEQQVLIHK YLAAGVRVPT HLLVPIWKSA ARTLGSNINV IGFSPVGFDY RSMMDPEPGR  120
CRRTDGKKWR CSRNTVPHQK YCERHMHRGR QRSRKPVEAS ENESPSKRIQ LNIPDRDARC  180
TLDVPTSTIC GNIKTKNHSS CNFTTAIPFL PVEAAVPGPK TVSDTRTKSV TETITGSMHG  240
TAAIVTSCAD ATKTNRMVPA SAPNTTATCI TTVPSVNPNA TNSISTGYIA DLKDICNMNF  300
RDNCSKSRNN AGRNDPNIQK IASPSLGFSP NSVLQVPGCS SSLCDSKINL ELEPGRCRRT  360
DGKKWRCRRD VIPDQKYCAL HMHRGSKKHL KPIQNAPVLA PCVASYGTML PLVTTPLTKL  420
EPATPNTNLS MSIQVDNKQR PTKARSNASS SSETTITDTT ITG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650785.10.0PREDICTED: growth-regulating factor 9 isoform X2
TrEMBLA0A0A0L9160.0A0A0A0L916_CUCSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.13e-47growth-regulating factor 9
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]