PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.257800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 548aa    MW: 60467.9 Da    PI: 9.9026
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.257800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.7e-24199243145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++ +k+CErH+hrgr+rsrk++e+
  Cucsa.257800.1 199 DPEPGRCRRTDGKKWRCSRNTVPHQKYCERHMHRGRQRSRKPVEA 243
                     79****************************************997 PP

2WRC63.33.7e-20436475241
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                      epgrCrRtDGKkWRC+r+v++++k+C  H+hrg+++  k
  Cucsa.257800.1 436 LEPGRCRRTDGKKWRCRRDVIPDQKYCALHMHRGSKKHLK 475
                     59********************************887655 PP

3QLQ47.36.4e-17128164137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     s +Ta Qlq+L++Q+l+ KyLaa++ vP +Ll++i+k
  Cucsa.257800.1 128 SILTAGQLQELEQQVLIHKYLAAGVRVPTHLLVPIWK 164
                     579********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.7E-8128164IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.498129164IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-10130163IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.432199243IPR014977WRC domain
PfamPF088792.6E-20200242IPR014977WRC domain
PROSITE profilePS5166720.514435479IPR014977WRC domain
PfamPF088791.0E-17437475IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MKEREREREV LVFLAFSDLK NLFIFIAFKI LQQCFDNRAH VSEIPMEVHP LQSFPSSETG  60
RGLLRLRKAD EVATAVMMME VKKEVNQSEN DEVSTPVLPS INLGLQIGTN SAGSRNERNS  120
IVRRSRESIL TAGQLQELEQ QVLIHKYLAA GVRVPTHLLV PIWKSAARTL GSNINGIYES  180
YRSFIGFSPV GFDYRSMMDP EPGRCRRTDG KKWRCSRNTV PHQKYCERHM HRGRQRSRKP  240
VEASENESPS KRIQLNIPDR DARCTLDVPT STICGNIKTK NHSSCNFTTA IPFLPVEAAV  300
PGPKTVSDTR TKSVTETITG SMHGTAAIVT SCADATKTNR MVPASAPNTT ATCITTVPSV  360
NPNATNSIST GYIADLKDIC NMNFRDNCSK SRNNAGRNDP NIQKIASPSL GFSPNSVLQV  420
PGCSSSLCDS KINLELEPGR CRRTDGKKWR CRRDVIPDQK YCALHMHRGS KKHLKPIQNA  480
PVLAPCVASY GTMLPLVTTP LTKLEPATPN TNLSMSIQVD NKQRPTKARS NASSSSETTI  540
TDTTITG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650784.10.0PREDICTED: growth-regulating factor 9 isoform X1
RefseqXP_004133902.10.0PREDICTED: growth-regulating factor 9 isoform X1
TrEMBLA0A0A0L9160.0A0A0A0L916_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.19e-46growth-regulating factor 9