PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.250990.1
Common NameCsa_3G180300, LOC101216878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 155aa    MW: 17142.6 Da    PI: 7.7419
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.250990.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.4e-3951041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dC+++p fp+++p++f +vh+++Gasnv k+l++lp++ r +a+++l++eA++r++dPvyG+vg+i++lq++l+ ++++la
  Cucsa.250990.1   5 RCAACKYLRRRCPSDCIFSPFFPSNNPQRFTIVHRIYGASNVAKFLHQLPTHLRAEAAETLIFEAKCRIEDPVYGCVGIISQLQHELHVAETQLA 99 
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Cucsa.250990.1 100 KTRAE 104
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1414105IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MISGRCAACK YLRRRCPSDC IFSPFFPSNN PQRFTIVHRI YGASNVAKFL HQLPTHLRAE  60
AAETLIFEAK CRIEDPVYGC VGIISQLQHE LHVAETQLAK TRAEIACVAS NVQEQPQPQD  120
FAFEPIQGPN SVGFSQIGLS TPAHCFNSTF FLNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-34610512111LOB family transfactor Ramosa2.1
5ly0_B3e-34610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-133LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-133LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140854.11e-111PREDICTED: LOB domain-containing protein 24-like
SwissprotP594689e-51LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0A0L9N71e-110A0A0A0L9N7_CUCSA; Uncharacterized protein
STRINGXP_004140854.11e-111(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-53LOB domain-containing protein 24
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]