PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.242570.1
Common NameCsa_3G800720, LOC101222778
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 386aa    MW: 41687.7 Da    PI: 6.1249
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.242570.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.86.9e-17234288256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k q   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Cucsa.242570.1 234 RKKLRLSKLQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 288
                     6788899**********************************************98 PP

2HD-ZIP_I/II122.81.6e-39234324192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+ke +eLr +lk
  Cucsa.242570.1 234 RKKLRLSKLQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELR-ALK 324
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-18219291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-16220288IPR009057Homeodomain-like
PROSITE profilePS5007116.665230290IPR001356Homeobox domain
SMARTSM003893.2E-14232294IPR001356Homeobox domain
PfamPF000462.2E-14234288IPR001356Homeobox domain
CDDcd000864.88E-14234291No hitNo description
PROSITE patternPS000270265288IPR017970Homeobox, conserved site
PfamPF021831.1E-10290324IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-25290333IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MVELGLSLGD HPSSNSNSNN KKKPFSNFLS KPISSSSNSS SSLMALGFCV GLIGRHSASA  60
SASASVQDDE EDEEQDDEDE DDDRKTVVLA GSTSGLDPPV QLDLLPLAPV PRSSSSSSPL  120
LPFPWLSHHL MGEVGGSSEG GERVETVDVK RVVVEEREDR VAAVAVAALS SPNSTVSCFE  180
MEFGGGGGGG GGIRRKRSWD HMEMETERGG GGGGCSRIMS DDEDNNASAS AAARKKLRLS  240
KLQSAFLEES FKEHTTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLR  300
RCCETLTEEN RRLQKELQEL RALKTSQPFY MQLPATTLTM CPSCERVATT TTTTPAPTTP  360
APSSALCLAN KPKILPFPHL HQAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1282290RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136729.20.0PREDICTED: homeobox-leucine zipper protein HOX11
TrEMBLA0A0A0LEE10.0A0A0A0LEE1_CUCSA; Uncharacterized protein
STRINGXP_004136729.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-55homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]