PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.228450.1
Common NameCsa_2G336070, LOC105434745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 369aa    MW: 42265.6 Da    PI: 6.6097
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.228450.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.61.8e-19952144
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    k i+n+  r++tf kR++ +l KA+ELS+LCd++v+v++ ++++
  Cucsa.228450.1  9 KLISNEKSRKTTFHKRKASLLRKAYELSTLCDVRVCVVVHGPNQ 52
                    569**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.554147IPR002100Transcription factor, MADS-box
SMARTSM004328.2E-19160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-212101IPR002100Transcription factor, MADS-box
CDDcd002665.35E-23278No hitNo description
PRINTSPR004043.5E-11323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-181152IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRGKLSMKL ISNEKSRKTT FHKRKASLLR KAYELSTLCD VRVCVVVHGP NQSNDQSPLQ  60
LHTWPPSADE VNNMIASYKT NCLYKRVRKS FGLIDFFSER KKKVETDMSK LRKDVSEERF  120
PSWDERLDHL LEDQLRVLMV ELDSKIEIAK KRIEIATENN YNVEEGTSVE SSGQTLNANM  180
KCKQVMGFDH EEESTDYGMF GIRSSMEQTQ GIMPFHHHHH HHHQQQQLQT MAQSCLQMDH  240
EIENLSPFLF GSNGSAPQFQ LSYGSNTNNC FQNYPHSFYN DPTNGMIMEN TQSYSSMCHY  300
GVPFGAQSVV PISYMQMQQL TAGAEDQMMM GYASTSQMAL PNTASSQVIN DPFDFYNSYE  360
YLMKPNNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650173.10.0PREDICTED: floral homeotic protein DEFICIENS-like
TrEMBLA0A0A0LME60.0A0A0A0LME6_CUCSA; Uncharacterized protein
STRINGXP_008460878.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-22M-type_MADS family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]