PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.213810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WOX
Protein Properties Length: 185aa    MW: 20371.6 Da    PI: 5.2229
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.213810.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.83.3e-122472346
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkv 46
                    +R+++tkeq+ +Le+l+++  r+psa+++++++ +l    +++ ++V++
  Cucsa.213810.1 24 SRWNPTKEQISILENLYRQgVRTPSADQIQQITVRLkdygHIEGKNVFY 72
                    7*****************99**************************986 PP

2Wus_type_Homeobox83.42.8e-272272252
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfy 52
                       +++RW+Pt+eQi iLe+ly++G+rtP++++iq+it +L+ yG+ie+kNVfy
     Cucsa.213810.1 22 VSSRWNPTKEQISILENLYRQGVRTPSADQIQQITVRLKDYGHIEGKNVFY 72
                       579***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000468.5E-102472IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEKMTAEVGD GGGGVGGGGP PVSSRWNPTK EQISILENLY RQGVRTPSAD QIQQITVRLK  60
DYGHIEGKNV FYCPYYVHQN DVGLYPQYQN NSMVIQSGGI VKKRSKSERR NCIININEES  120
TINDNNLSYQ TTETLSLFPT HPTGDLQASP QSPPPPSMVP TSASDEISVD DSAHGRQPYF  180
EFFM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819261e-134LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132661e-134LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150189.26e-90PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A0A0LVA91e-88A0A0A0LVA9_CUCSA; Uncharacterized protein
STRINGXP_004163652.19e-98(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-25WUSCHEL related homeobox 2