PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.203800.1
Common NameCsa_3G731130, LOC101211490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 308aa    MW: 36271.1 Da    PI: 7.529
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.203800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.86.8e-2460142186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++ + +r e+++++ ++k++k lWe  ++km+e+gf+rs++qCk+kw+nl +ryk ++++e +    s++++p++++l+
  Cucsa.203800.1  60 QWSIQETKEFLMIRAELDQTFMETKRNKLLWEITASKMKEKGFNRSAEQCKCKWKNLVTRYKGCETMEPEI---SRQQFPFYTELQ 142
                     7********************************************************************97...55679****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.21E-2259124No hitNo description
PfamPF138372.7E-1960144No hitNo description
PROSITE profilePS500906.81861117IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEGHHHPHPH PHPHPHPHPL IHLHQQQQIQ HPPPPPPHLH QSLAVDQATT ATAIADRFPQ  60
WSIQETKEFL MIRAELDQTF METKRNKLLW EITASKMKEK GFNRSAEQCK CKWKNLVTRY  120
KGCETMEPEI SRQQFPFYTE LQAIFGARRE RLLWAEAESG GSGLKKKMMV LSSDDEDEND  180
DSDGDGGETK VSGRKRKKVK GTTMGGAEGS GKSSMNELKE ILEDFMNQQM QMEVQWREAF  240
EAREKERQMK EMEWRRNMEA LEHERIMLER RWREREEQRR MREEVRAEKR DALITALLNK  300
LRRDDHI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193197RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM8548200.0HM854820.1 Cucumis melo subsp. melo clone 00002, complete sequence.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137715.20.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW09e-72TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0A0LF980.0A0A0A0LF98_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.14e-65Trihelix family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]