PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.201200.1
Common NameCsa_4G043890, LOC101221784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GATA
Protein Properties Length: 308aa    MW: 34241.2 Da    PI: 5.453
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.201200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18228262135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Cucsa.201200.1 228 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 262
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-833306IPR016679Transcription factor, GATA, plant
SuperFamilySSF577162.47E-14221284No hitNo description
SMARTSM004012.2E-16222276IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.807222258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-14226260IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.98E-14227275No hitNo description
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16228262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MIMECVRLSP QLCFNPQNVV SSDDFFVDQL LDLSDHDEFL QDQTPDDDDD DDKPSVSLSN  60
LVSAQEIHQD SIVSDFPSLP TSELTVPADD LEDLEWLSHF VEDSFSGFSA PFPSPMKSSK  120
EIATSEEQLV EDDGSVSPPE PCFKTPIPAK ARSKRRRTSG RVWCLRSPSL TDSSSCSTTS  180
SSSSSPASPW LIISDRFEPE IPATKKRRRK SPSEKSRITI GAQPPRRCSH CGVQKTPQWR  240
TGPLGAKTLC NACGVRFKSG RLLPEYRPAC SPNFSSELHS NHHRKVLEMR RKKEVTAPDE  300
FLSVEKN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204209KKRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6832810.0LN683281.1 Cucumis melo genomic scaffold, unanchored_scaffold01473.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146485.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH576e-76GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0A0KUP50.0A0A0A0KUP5_CUCSA; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-66GATA transcription factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]