PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.198630.1
Common NameCsa_1G015680, LOC101221286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 551aa    MW: 60182.1 Da    PI: 7.783
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.198630.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.6e-42175251278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Cucsa.198630.1 175 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 251
                     **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33169236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.83E-39173252IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MESWSYVSEG KGCMSDEMNS PTSSLARNKD SLLGWEFKNP CSFGSTMLPT SQQVDNQGFG  60
ELVFPEMIGK QLPDNSVCDI LSSKVVGGRF LNPAMNSSIA FLGEDESTSK LSSSIVDSSS  120
RDSSFIDLKL GRFADQRDAH GYKFFKGAPI LSSSESSMPS KRVRASGLNS QTYFCQVYGC  180
NKDLSSCKDY HKRHKVCEVH SKTAKVIVNG IEQRFCQQCS RFHLLAEFDD GKRSCRKRLA  240
GHNERRRKPQ VAINSGRTGR FLQSYNGSRL QGTALTATSF ICQEILPNGL LHPEKYGTSD  300
WCRTVKIEDK NEYMPLSAVH VPSGHLHSKS LFSPYDIETQ VPPFHDNGPN ASATNIFKEN  360
SNQYPLSVGG VNSNSRSYFH NPSLGSEYFS VYSAASTDRL SGLSDSGCAL SLLSSQTQNS  420
STHSSGIPIG RPLVLLDGQN HYSMSQLSEK LMGVSSQVSV SGVSNKFNSS GLNTSEGCTL  480
GPISTPETSD AVNFEISNRI FHGSNLADPG EGGPTIDLLQ LSSQLQRVEH QRQAMQVKQE  540
SNAFCCLRIT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291742481084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138332.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011648639.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011648643.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0A0LRX60.0A0A0A0LRX6_CUCSA; Uncharacterized protein
STRINGXP_004138332.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-47SBP family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]