PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.197700.1
Common NameCsa_1G009740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 204aa    MW: 23562.6 Da    PI: 8.4506
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.197700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.22.2e-2564114252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +k +s +++++y+++pi++AAkeL+v+lT+LK++CR++GI RWPhRk+ s+
  Cucsa.197700.1  64 SKMLSRKVIQEYYYMPITQAAKELNVGLTLLKKRCRELGIGRWPHRKLMSI 114
                     57899*******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.9550134IPR003035RWP-RK domain
PfamPF020421.1E-2067114IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MDNGVFGVVE EEPPLLLLEC GENEEKEEMV VSNKKGKKRS MRLKSENECS NNNSNNNGSC  60
YSSSKMLSRK VIQEYYYMPI TQAAKELNVG LTLLKKRCRE LGIGRWPHRK LMSIQTLIKN  120
IKELIEKGDD EEGNGSENYK LKNVLEILEN EKKLMEERPD LQLEDNTKRL RQACFKANYK  180
KRKLSGLIIN NNNNNNIDDI NSQX
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-128LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-128LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011660335.11e-142PREDICTED: protein RKD1-like
SwissprotQ9M9U94e-50RKD1_ARATH; Protein RKD1
TrEMBLA0A0A0LP421e-140A0A0A0LP42_CUCSA; Uncharacterized protein
STRINGXP_004155063.11e-143(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-50RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]